KEGG   Homo sapiens (human): 5754Help
Entry
5754              CDS       T01001                                 

Gene name
PTK7, CCK-4, CCK4
Definition
(RefSeq) protein tyrosine kinase 7 (inactive) (EC:2.7.10.1)
  KO
K05127  
PTK7 protein tyrosine kinase 7 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5754 (PTK7)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  PTK7 family
   5754 (PTK7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5754 (PTK7)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class XV (KLG receptor family)
   5754 (PTK7)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class XV (KLG receptor family)
   5754 (PTK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1-p12.2
AA seq 1070 aa AA seqDB search
MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGP
VHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSS
KERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQDVVVARYE
EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGIYR
CIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYR
CMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSG
RYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
KRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgcgcggggatccccggccagaccccgccggttgcctctgctcagcgtcctg
ctgctgccgctgctgggcggtacccagacagccattgtcttcatcaagcagccgtcctcc
caggatgcactgcaggggcgccgggcgctgcttcgctgtgaggttgaggctccgggcccg
gtacatgtgtactggctgctcgatggggcccctgtccaggacacggagcggcgtttcgcc
cagggcagcagcctgagctttgcagctgtggaccggctgcaggactctggcaccttccag
tgtgtggctcgggatgatgtcactggagaagaagcccgcagtgccaacgcctccttcaac
atcaaatggattgaggcaggtcctgtggtcctgaagcatccagcctcggaagctgagatc
cagccacagacccaggtcacacttcgttgccacattgatgggcaccctcggcccacctac
caatggttccgagatgggacccccctttctgatggtcagagcaaccacacagtcagcagc
aaggagcggaacctgacgctccggccagctggtcctgagcatagtgggctgtattcctgc
tgcgcccacagtgcttttggccaggcttgcagcagccagaacttcaccttgagcattgct
gatgaaagctttgccagggtggtgctggcaccccaggacgtggtagtagcgaggtatgag
gaggccatgttccattgccagttctcagcccagccacccccgagcctgcagtggctcttt
gaggatgagactcccatcactaaccgcagtcgccccccacacctccgcagagccacagtg
tttgccaacgggtctctgctgctgacccaggtccggccacgcaatgcagggatctaccgc
tgcattggccaggggcagaggggcccacccatcatcctggaagccacacttcacctagca
gagattgaagacatgccgctatttgagccacgggtgtttacagctggcagcgaggagcgt
gtgacctgccttccccccaagggtctgccagagcccagcgtgtggtgggagcacgcggga
gtccggctgcccacccatggcagggtctaccagaagggccacgagctggtgttggccaat
attgctgaaagtgatgctggtgtctacacctgccacgcggccaacctggctggtcagcgg
agacaggatgtcaacatcactgtggccactgtgccctcctggctgaagaagccccaagac
agccagctggaggagggcaaacccggctacttggattgcctgacccaggccacaccaaaa
cctacagttgtctggtacagaaaccagatgctcatctcagaggactcacggttcgaggtc
ttcaagaatgggaccttgcgcatcaacagcgtggaggtgtatgatgggacatggtaccgt
tgtatgagcagcaccccagccggcagcatcgaggcgcaagcccgtgtccaagtgctggaa
aagctcaagttcacaccaccaccccagccacagcagtgcatggagtttgacaaggaggcc
acggtgccctgttcagccacaggccgagagaagcccactattaagtgggaacgggcagat
gggagcagcctcccagagtgggtgacagacaacgctgggaccctgcattttgcccgggtg
actcgagatgacgctggcaactacacttgcattgcctccaacgggccgcagggccagatt
cgtgcccatgtccagctcactgtggcagtttttatcaccttcaaagtggaaccagagcgt
acgactgtgtaccagggccacacagccctactgcagtgcgaggcccagggggaccccaag
ccgctgattcagtggaaaggcaaggaccgcatcctggaccccaccaagctgggacccagg
atgcacatcttccagaatggctccctggtgatccatgacgtggcccctgaggactcaggc
cgctacacctgcattgcaggcaacagctgcaacatcaagcacacggaggcccccctctat
gtcgtggacaagcctgtgccggaggagtcggagggccctggcagccctcccccctacaag
atgatccagaccattgggttgtcggtgggtgccgctgtggcctacatcattgccgtgctg
ggcctcatgttctactgcaagaagcgctgcaaagccaagcggctgcagaagcagcccgag
ggcgaggagccagagatggaatgcctcaacggtgggcctttgcagaacgggcagccctca
gcagagatccaagaagaagtggccttgaccagcttgggctccggccccgcggccaccaac
aaacgccacagcacaagtgataagatgcacttcccacggtctagcctgcagcccatcacc
acgctggggaagagtgagtttggggaggtgttcctggcaaaggctcagggcttggaggag
ggagtggcagagaccctggtacttgtgaagagcctgcagagcaaggatgagcagcagcag
ctggacttccggagggagttggagatgtttgggaagctgaaccacgccaacgtggtgcgg
ctcctggggctgtgccgggaggctgagccccactacatggtgctggaatatgtggatctg
ggagacctcaagcagttcctgaggatttccaagagcaaggatgaaaaattgaagtcacag
cccctcagcaccaagcagaaggtggccctatgcacccaggtagccctgggcatggagcac
ctgtccaacaaccgctttgtgcataaggacttggctgcgcgtaactgcctggtcagtgcc
cagagacaagtgaaggtgtctgccctgggcctcagcaaggatgtgtacaacagtgagtac
taccacttccgccaggcctgggtgccgctgcgctggatgtcccccgaggccatcctggag
ggtgacttctctaccaagtctgatgtctgggccttcggtgtgctgatgtgggaagtgttt
acacatggagagatgccccatggtgggcaggcagatgatgaagtactggcagatttgcag
gctgggaaggctagacttcctcagcccgagggctgcccttccaaactctatcggctgatg
cagcgctgctgggccctcagccccaaggaccggccctccttcagtgagattgccagcgcc
ctgggagacagcaccgtggacagcaagccgtga

DBGET integrated database retrieval system