KEGG   Homo sapiens (human): 57546Help
Entry
57546             CDS       T01001                                 

Gene name
PDP2, PPM2B, PPM2C2
Definition
(RefSeq) pyruvate dehyrogenase phosphatase catalytic subunit 2 (EC:3.1.3.43)
  KO
K01102  
pyruvate dehydrogenase phosphatase [EC:3.1.3.43]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.43  [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase
     57546 (PDP2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   Pyruvate dehydrogenase phosphatases
    Catalytic subunit
     57546 (PDP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 529 aa AA seqDB search
MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLC
KAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPV
EDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESM
KPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDS
DISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMW
SCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQ
RSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN
EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIG
NNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtactgtgtcctactggatcttaaattctacaaggaacagcattgccacattg
caagggggtagacgcttatactccaggtatgtctcaaataggaataaattaaaatggagg
ctcttttcccgggtgccacccaccctaaacagttccccatgtggtggctttactctgtgc
aaagcctacagacacacatcaacagaggaagatgattttcacttgcaactcagccctgag
cagataaatgaagtgcttcgagctggcgagacaacccacaagattcttgaccttgaaagc
agagtcccaaattcagtgttgcggtttgagagcaaccagctggctgccaattccccagtg
gaggaccggcgaggtgtagcctcctgcctgcaaaccaatggactgatgtttggcatcttc
gatggacatggtggtcatgcatgtgcccaagcagtgagcgagaggctcttctactatgtg
gcagtgtccctgatgtcccaccagaccctggagcacatggagggagctatggaaagcatg
aaacccttgctgcccatcctgcattggctcaagcacccaggggacagtatctacaaggat
gtcacatctgtgcatcttgaccacctccgtgtctattggcaggaactgcttgatttgcac
atggaaatgggactaagcattgaagaagcattaatgtactccttccagagactggattct
gacatctcgctggaaatccaggcccccctggaagatgaggtgacaaggaacctgtcactc
caggttgctttctctggggcaacagcttgcatggcccatgttgatggaattcacttgcac
gtggcaaatgctggtgactgccgagccatccttggtgtccaagaggacaatggcatgtgg
tcttgtctgccccttacacgtgaccacaatgcctggaaccaggccgagctgtcccggcta
aagagggagcaccctgagtcagaggacaggacgatcatcatggaggacaggctactgggc
gtcctcatcccctgcagggcctttggggatgttcagctgaagtggagtaaagagttgcag
cgcagcattctggagaggggcttcaataccgaggccctcaacatttaccagttcacaccc
ccacactactacactccaccctacctgactgctgagcctgaggtcacataccacaggctg
aggccccaggataagttccttgtgctggcctcagatggcctgtgggacatgctgagcaat
gaggacgtggtaaggctggtggtggggcacctggctgaggcagattggcacaagacagac
ctggcccagagacccgccaacttggggctcatgcagagcctgctgctgcagaggaaagcc
agcgggctccacgaggctgaccaaaatgcagccacgcggctgatcagacatgccatcggg
aacaatgagtatggggagatggaggcagagcggctggcggcgatgctgacattgccagag
gacttggcgaggatgtacagggatgatatcactgtcactgtggtgtattttaactcagaa
tcaatcggtgcatattacaaggggggttaa

DBGET integrated database retrieval system