KEGG   Homo sapiens (human): 57552Help
Entry
57552             CDS       T01001                                 

Gene name
NCEH1, AADACL1, NCEH
Definition
neutral cholesterol ester hydrolase 1 (EC:3.1.1.-)
Orthology
K14349  
neutral cholesterol ester hydrolase 1 [EC:3.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    57552 (NCEH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     57552 (NCEH1)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   57552 (NCEH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.31
AA seq 448 aa AA seqDB search
MSSCRGQKVAGGLRVVSPFPLCQPAGEPSQGKMRSSCVLLTALVALAAYYVYIPLPGSVS
DPWKLMLLDATFRGAQQVSNLIHYLGLSHHLLALNFIIVSFGKKSAWSSAQVKVTDTDFD
GVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASASASWSPSDEIRYYDELCTAMAEELNA
VIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAAL
GQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNY
DFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLL
DARSAPLIADQAVLQLLPKTYILTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGC
MIFTSWPTNFSVGIRTRNSYIKWLDQNL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctgccgcgggcagaaagttgccggaggtctccgggtggtatcgccctttcct
ctttgccagcccgctggcgagccgagccagggcaagatgaggtcgtcctgtgtcctgctc
accgccctggtggcgctggccgcctattacgtctacatcccgctgcctggctccgtgtcc
gacccctggaagctgatgctgctggacgccactttccggggtgcacagcaagtgagtaac
ctgatccactacctgggactgagccatcacctgctggcactgaattttatcattgtttct
tttggcaaaaaaagcgcgtggtcttctgcccaagtgaaggtgaccgacacagactttgat
ggtgtggaagtcagagtgtttgaaggccctccgaagcccgaagagccactgaaacgcagc
gtcgtttatatccacggaggaggctgggccttggcaagtgcaagtgcgtcctggtcacct
tcagatgaaatcaggtattatgatgagctgtgtacagcaatggctgaggaattgaatgct
gtcattgtttccattgaatacaggctagttccaaaggtttattttcctgagcaaattcat
gatgttgtacgggccacaaagtatttcctgaagccagaagtcttacagaagtatatggtt
gatccaggcagaatttgcatttctggtgacagtgctggtggaaatctggctgctgccctt
ggacaacagtttactcaagatgccagcctaaaaaataagctcaaactacaagctttaatt
tatccagttcttcaagctttagattttaacacaccatcttatcagcaaaatgtgaacacc
ccaatcctgccccgctatgtcatggtgaagtattgggtggactacttcaaaggcaactat
gactttgtgcaggcaatgatcgttaacaatcacacttcacttgatgtggaagaggctgct
gctgtcagggcccgtctaaactggacatccctcttgcctgcatccttcacaaagaactac
aagcctgttgtacagaccacaggcaatgccaggattgtccaggagcttcctcagttgctg
gatgcccgctccgccccactcattgcagaccaggcagtgctgcagctcctcccaaagacc
tacattctgacgtgtgagcatgatgtcctcagagacgatggcatcatgtatgccaagcgt
ttggagagtgccggtgtggaggtgaccctggatcactttgaggatggctttcacggatgt
atgattttcactagctggcccaccaacttctcagtgggaatccggactaggaatagttac
atcaagtggctagatcaaaacctgtaa

DBGET integrated database retrieval system