KEGG   Homo sapiens (human): 57555Help
Entry
57555             CDS       T01001                                 

Gene name
NLGN2
Definition
(RefSeq) neuroligin 2
  KO
K07378  
neuroligin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    57555 (NLGN2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    57555 (NLGN2)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRXN; neurexin [KO:K07377]
   57555 (NLGN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8NFZ4(Tbio)
UniProt: 
Position
17p13.1
AA seq 835 aa AA seqDB search
MWLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRELNN
EILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLP
VWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVM
LFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQ
ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIAFGPVVDGDVV
PDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYF
YTFYHHCQAEGRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTN
FAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
WLELVPHLHNLHTELFTTTTRLPPYATRWPPRPPAGAPGTRRPPPPATLPPEPEPEPGPR
AYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYYKRDRRQELRCRRLSPPGGSGS
GVPGGGPLLPAAGRELPPEEELVSLQLKRGGGVGADPAEALRPACPPDYTLALRRAPDDV
PLLAPGALTLLPSGLGPPPPPPPPSLHPFGPFPPPPPTATSHNNTLPHPHSTTRV
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcctggcgctgtgtctggtggggctggcgggggctcaacgcgggggagggggt
cccggcggcggcgccccgggcggccccggcctgggcctcggcagcctcggcgaggagcgc
ttcccggtggtgaacacggcctacgggcgagtgcgcggtgtgcggcgcgagctcaacaac
gagatcctgggccccgtcgtgcagttcttgggcgtgccctacgccacgccgcccctgggc
gcccgccgcttccagccgcctgaggcgcccgcctcgtggcccggcgtgcgcaacgccacc
accctgccgcccgcctgcccgcagaacctgcacggggcgctgcccgccatcatgctgcct
gtgtggttcaccgacaacttggaggcggccgccacctacgtgcagaaccagagcgaggac
tgcctgtacctcaacctctacgtgcccaccgaggacggtccgctcacaaaaaaacgtgac
gaggcgacgctcaatccgccagacacagatatccgtgaccctgggaagaagcctgtgatg
ctgtttctccatggcggctcctacatggaggggaccggaaacatgttcgatggctcagtc
ctggctgcctatggcaacgtcattgtagccacgctcaactaccgtcttggggtgctcggt
tttctcagcaccggggaccaggctgcaaaaggcaactatgggctcctggaccagatccag
gccctgcgctggctcagtgaaaacatcgcccactttgggggcgaccccgagcgtatcacc
atctttggttccggggcaggggcctcctgcgtcaaccttctgatcctctcccaccattca
gaagggctgttccagaaggccatcgcccagagtggcaccgccatttccagctggtctgtc
aactaccagccgctcaagtacacgcggctgctggcagccaaggtgggctgtgaccgagag
gacagcgctgaagctgtggagtgtctgcgccggaagccctcccgggagctggtggaccag
gacgtgcagcctgcccgctaccacatcgcctttgggcccgtggtggatggcgacgtggtc
cccgatgaccctgagatcctcatgcagcagggagaattcctcaactacgacatgctcatc
ggcgtcaaccagggagagggcctcaagttcgtggaggactctgcagagagcgaggacggt
gtgtctgccagcgcctttgacttcactgtctccaactttgtggacaacctgtatggctac
ccggaaggcaaggatgtgcttcgggagaccatcaagtttatgtacacagactgggccgac
cgggacaatggcgaaatgcgccgcaaaaccctgctggcgctctttactgaccaccaatgg
gtggcaccagctgtggccactgccaagctgcacgccgactaccagtctcccgtctacttt
tacaccttctaccaccactgccaggcggagggccggcctgagtgggcagatgcggcgcac
ggggatgaactgccctatgtctttggcgtgcccatggtgggtgccaccgacctcttcccc
tgtaacttctccaagaatgacgtcatgctcagtgccgtggtcatgacctactggaccaac
ttcgccaagactggggaccccaaccagccggtgccgcaggataccaagttcatccacacc
aagcccaatcgcttcgaggaggtggtgtggagcaaattcaacagcaaggagaagcagtat
ctgcacataggcctgaagccacgcgtgcgtgacaactaccgcgccaacaaggtggccttc
tggctggagctcgtgccccacctgcacaacctgcacacggagctcttcaccaccaccacg
cgcctgcctccctacgccacgcgctggccgcctcgtccccccgctggcgccccgggcaca
cgccggcccccgccgcctgccaccctgcctcccgagcccgagcccgagcccggcccaagg
gcctatgaccgcttccccggggactcacgggactactccacggagctgagcgtcaccgtg
gccgtgggtgcctccctcctcttcctcaacatcctggcctttgctgccctctactacaag
cgggaccggcggcaggagctgcggtgcaggcggcttagcccacctggcggctcaggctct
ggcgtgcctggtgggggccccctgctccccgccgcgggccgtgagctgccaccagaggag
gagctggtgtcactgcagctgaagcggggtggtggcgtcggggcggaccctgccgaggct
ctgcgccctgcctgcccgcccgactacaccctggccctgcgccgggcaccggacgatgtg
cctctcttggcccccggggccctgaccctgctgcccagtggcctggggccaccgccaccc
ccaccgcccccctcccttcatcccttcgggcccttccccccgccccctcccaccgccacc
agccacaacaacacgctaccccacccccactccaccactcgggtatag

DBGET integrated database retrieval system