KEGG   Homo sapiens (human): 57556Help
Entry
57556             CDS       T01001                                 

Gene name
SEMA6A, HT018, SEMA, SEMA6A1, SEMAQ, VIA
Definition
sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A
Orthology
K06842  
semaphorin 6
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    57556 (SEMA6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q23.1
AA seq 1047 aa AA seqDB search
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHRLDIQM
IMIMNGTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDALFVCGTNAFNPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGESPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIASVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNSEKCSYD
GVEDKRIMGMQLDRASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWIKEGG
ACSHLSPNSRLTFEQDIERGNTDGLGDCHNSFVALNDISTPLPDNEMSYNTVYGHSSSLL
PSTTTSDSTAQEGYESRGGMLDWKHLLDSPDSTDPLGAVSSHNHQDKKGVIRESYLKGHD
QLVPVTLLAIAVILAFVMGAVFSGITVYCVCDHRRKDVAVVQRKEKELTHSRRGSMSSVT
KLSGLFGDTQSKDPKPEAILTPLMHNGKLATPGNTAKMLIKADQHHLDLTALPTPESTPT
LQQKRKPSRGSREWERNQNLINACTKDMPPMGSPVIPTDLPLRASPSHIPSVVVLPITQQ
GYQHEYVDQPKMSEVAQMALEDQAATLEYKTIKEHLSSKSPNHGVNLVENLDSLPPKVPQ
REASLGPPGASLSQTGLSKRLEMHHSSSYGVDYKRSYPTNSLTRSHQATTLKRNNTNSSN
SSHLSRNQSFGRGDNPPPAPQRVDSIQVHSSQPSGQAVTVSRQPSLNAYNSLTRSGLKRT
PSLKPDVPPKPSFAPLSTSMKPNDACT
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcagaagccttgctgctatatttcacactgctacactttgctggggctggtttc
ccagaagattctgagccaatcagtatttcgcatggcaactatacaaaacagtatccggtg
tttgtgggccacaagccaggacggaacaccacacagaggcacaggctggacatccagatg
attatgatcatgaacggaaccctctacattgctgctagggaccatatttatactgttgat
atagacacatcacacacggaagaaatttattgtagcaaaaaactgacatggaaatctaga
caggccgatgtagacacatgcagaatgaagggaaaacataaggatgagtgccacaacttt
attaaagttcttctaaagaaaaacgatgatgcattgtttgtctgtggaactaatgccttc
aacccttcctgcagaaactataagatggatacattggaaccattcggggatgaattcagc
ggaatggccagatgcccatatgatgccaaacatgccaacgttgcactgtttgcagatgga
aaactatactcagccacagtgactgacttccttgccattgacgcagtcatttaccggagt
cttggagaaagccctaccctgcggaccgtcaagcacgattcaaaatggttgaaagaacca
tactttgttcaagccgtggattacggagattatatctacttcttcttcagggaaatagca
gtggagtataacaccatgggaaaggtagttttcccaagagtggctcaggtttgtaagaat
gatatgggaggatctcaaagagtcctggagaaacagtggacgtcgttcctgaaggcgcgc
ttgaactgctcagttcctggagactctcatttttatttcaacattctccaggcagttaca
gatgtgattcgtatcaacgggcgtgatgttgtcctggcaacgttttctacaccttataac
agcatccctgggtctgcagtctgtgcctatgacatgcttgacattgccagtgtttttact
gggagattcaaggaacagaagtctcctgattccacctggacaccagttcctgatgaacga
gttcctaagcccaggccaggttgctgtgctggctcatcctccttagaaagatatgcaacc
tccaatgagttccctgatgataccctgaacttcatcaagacgcacccgctcatggatgag
gcagtgccctccatcttcaacaggccatggttcctgagaacaatggtcagataccgcctt
accaaaattgcagtggacacagctgctgggccatatcagaatcacactgtggtttttctg
ggatcagagaagggaatcatcttgaagtttttggccagaataggaaatagtggttttcta
aatgacagccttttcctggaggagatgagtgtttacaactctgaaaaatgcagctatgat
ggagtcgaagacaaaaggatcatgggcatgcagctggacagagcaagcagctctctgtat
gttgcgttctctacctgtgtgataaaggttccccttggccggtgtgaacgacatgggaag
tgtaaaaaaacctgtattgcctccagagacccatattgtggatggataaaggaaggtggt
gcctgcagccatttatcacccaacagcagactgacttttgagcaggacatagagcgtggc
aatacagatggtctgggggactgtcacaattcctttgtggcactgaatgacatttcaact
cctctaccagataatgaaatgtcttacaacacagtgtatgggcattccagttccctcttg
cccagcacaaccacatcagattcgacggctcaagaggggtatgagtctaggggaggaatg
ctggactggaagcatctgcttgactcacctgacagcacagaccctttgggggcagtgtct
tcccataatcaccaagacaagaagggagtgattcgggaaagttacctcaaaggccacgac
cagctggttcccgtcaccctcttggccattgcagtcatcctggctttcgtcatgggggcc
gtcttctcgggcatcaccgtctactgcgtctgtgatcatcggcgcaaagacgtggctgtg
gtgcagcgcaaggagaaggagctcacccactcgcgccggggctccatgagcagcgtcacc
aagctcagcggcctctttggggacactcaatccaaagacccaaagccggaggccatcctc
acgccactcatgcacaacggcaagctcgccactcccggcaacacggccaagatgctcatt
aaagcagaccagcaccacctggacctgacggccctccccaccccagagtcaaccccaacg
ctgcagcagaagcggaagcccagccgcggcagccgcgagtgggagaggaaccagaacctc
atcaatgcctgcacaaaggacatgccccccatgggctcccctgtgattcccacggacctg
cccctgcgggcctcccccagccacatccccagcgtggtggtcctgcccatcacgcagcag
ggctaccagcatgagtacgtggaccagcccaaaatgagcgaggtggcccagatggcgctg
gaggaccaggccgccacactggagtataagaccatcaaggaacatctcagcagcaagagt
cccaaccatggggtgaaccttgtggagaacctggacagcctgccccccaaagttccacag
cgggaggcctccctgggtcccccgggagcctccctgtctcagaccggtctaagcaagcgg
ctggaaatgcaccactcctcttcctacggggttgactataagaggagctaccccacgaac
tcgctcacgagaagccaccaggccaccactctcaaaagaaacaacactaactcctccaat
tcctctcacctctccagaaaccagagctttggcaggggagacaacccgccgcccgccccg
cagagggtggactccatccaggtgcacagctcccagccatctggccaggccgtgactgtc
tcgaggcagcccagcctcaacgcctacaactcactgacaaggtcggggctgaagcgtacg
ccctcgctaaagccggacgtaccccccaaaccatcctttgctcccctttccacatccatg
aagcccaatgatgcgtgtacataa

DBGET integrated database retrieval system