KEGG   Homo sapiens (human): 57559Help
Entry
57559             CDS       T01001                                 

Gene name
STAMBPL1, ALMalpha, AMSH-FP, AMSH-LP, bA399O19.2
Definition
STAM binding protein-like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     57559 (STAMBPL1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M67
   57559 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.31
AA seq 436 aa AA seqDB search
MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccttttactgtgaattctctgaaaaagttagctgctatgcctgaccataca
gatgtttccctaagcccagaagagcgagtccgtgccctaagcaagcttggttgtaatatc
accatcagtgaagacatcactccacgacgttactttaggtctggagtagagatggagagg
atggcgtctgtgtatttggaagaaggaaatttggaaaatgcctttgttctttataataaa
tttataaccttatttgtagaaaagcttcctaaccatcgagattaccagcaatgtgcagta
cctgaaaagcaggatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaacgaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaaatataaagctgaaattctcaaaaaattggagcatcagagattgatagaggcagaa
aggaagcggattgctcagatgcgccagcagcagctagaatcggagcagtttctgtttttc
gaagatcaactcaagaagcaagagttagcccgaggtcaaatgcgaagtcagcaaacctca
gggctgtcagagcagattgatgggagcgctttgtcctgcttttccacacaccagaacaat
tccttgctgaatgtatttgcagatcaacctaataaaagtgatgcaaccaattatgctagc
cactctcctcctgtaaacagggccttaacgccagctgctactctaagtgctgttcagaat
ttagtggttgaaggactgcgatgtgtagttttgccagaagatctttgccacaaatttctg
caactggcagaatctaatacagtgagaggaatagaaacctgtggaatactctgtggaaaa
ctgacacataatgaatttactattacccatgtaattgtgccaaagcagtctgcgggacca
gactattgtgacatggagaatgtagaggaattattcaatgttcaggatcaacatgatctc
ctcactctaggatggatccatacacatcccactcaaactgcatttttatccagcgttgat
cttcacactcactgttcctatcaactcatgttgccagaggccattgccattgtttgctca
ccaaagcataaagacactggcatcttcaggctcaccaatgctggcatgcttgaggtttct
gcttgtaaaaaaaagggctttcatccacacaccaaggagcccaggctgttcagtatatgc
aaacatgtgttggtaaaagacataaaaataattgtgttggatctgaggtga

DBGET integrated database retrieval system