KEGG   Homo sapiens (human): 57582Help
Entry
57582             CDS       T01001                                 

Gene name
KCNT1, EIEE14, ENFL5, KCa4.1, SLACK, Slo2.2, bA100C15.2
Definition
(RefSeq) potassium sodium-activated channel subfamily T member 1
  KO
K04946  
potassium channel subfamily T member 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNT, KCa4.x
   57582 (KCNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.3
AA seq 1235 aa AA seqDB search
MPLPDGARTPGGVCREARGGGYTNRTFEFDDGQCAPRRPCAGDGALLDTAGFKMSDLDSE
VLPLPPRYRFRDLLLGDPSFQNDDRVQVEFYVNENTFKERLKLFFIKNQRSSLRIRLFNF
SLKLLTCLLYIVRVLLDDPALGIGCWGCPKQNYSFNDSSSEINWAPILWVERKMTLWAIQ
VIVAIISFLETMLLIYLSYKGNIWEQIFRVSFVLEMINTLPFIITIFWPPLRNLFIPVFL
NCWLAKHALENMINDFHRAILRTQSAMFNQVLILFCTLLCLVFTGTCGIQHLERAGENLS
LLTSFYFCIVTFSTVGYGDVTPKIWPSQLLVVIMICVALVVLPLQFEELVYLWMERQKSG
GNYSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYYVVILCPTEMDVQVRRVL
QIPLWSQRVIYLQGSALKDQDLMRAKMDNGEACFILSSRNEVDRTAADHQTILRAWAVKD
FAPNCPLYVQILKPENKFHVKFADHVVCEEECKYAMLALNCICPATSTLITLLVHTSRGQ
EGQESPEQWQRMYGRCSGNEVYHIRMGDSKFFREYEGKSFTYAAFHAHKKYGVCLIGLKR
EDNKSILLNPGPRHILAASDTCFYINITKEENSAFIFKQEEKRKKRAFSGQGLHEGPARL
PVHSIIASMGTVAMDLQGTEHRPTQSGGGGGGSKLALPTENGSGSRRPSIAPVLELADSS
ALLPCDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLR
LDKGCKHNSYEDAKAYGFKNKLIIVSAETAGNGLYNFIVPLRAYYRSRKELNPIVLLLDN
KPDHHFLEAICCFPMVYYMEGSVDNLDSLLQCGIIYADNLVVVDKESTMSAEEDYMADAK
TIVNVQTMFRLFPSLSITTELTHPSNMRFMQFRAKDSYSLALSKLEKRERENGSNLAFMF
RLPFAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLDTTPGSGYLCAMKITEGDLWIR
TYGRLFQKLCSSSAEIPIGIYRTESHVFSTSEPHDLRAQSQISVNVEDCEDTREVKGPWG
SRAGTGGSSQGRHTGGGDPAEHPLLRRKSLQWARRLSRKAPKQAGRAAAAEWISQQRLSL
YRRSERQELSELVKNRMKHLGLPTTGYDEMNDHQNTLSYVLINPPPDTRLEPSDIVYLIR
SDPLAHVASSSQSRKSSCSHKLSSCNPETRDETQL
NT seq 3708 nt NT seq  +upstreamnt  +downstreamnt
atgccactccctgacggggcgcggaccccggggggcgtctgccgggaggcgcgcggcggg
ggctacaccaaccggaccttcgagtttgacgacggccaatgcgcccccaggcggccctgc
gcgggggacggcgcgctcctggacaccgccggcttcaagatgagcgacctggactccgag
gtgctgcccttgccgccgcgctaccgcttccgggacctgctgctgggcgacccgtccttc
cagaacgacgacagggtccaggtggagttctacgtcaacgagaacaccttcaaggagcgg
ctcaagctgttcttcatcaaaaaccaaagatcgagcctgaggatccggctgttcaacttc
tccctgaagctgctcacctgcctgctctacattgtgcgcgtcctgctcgatgacccggcc
ctgggcatcggatgctggggctgcccaaagcagaactactccttcaatgactcgtcctcc
gagatcaactgggctcctattctgtgggtggagagaaagatgacactgtgggcgatccag
gtcatcgtggccataataagcttcctggagacgatgcttctcatctacctcagctacaaa
ggcaacatctgggagcagatcttccgcgtgtccttcgtcctggagatgatcaacactctg
cccttcatcatcacgatcttctggccgccgctgcggaacctgttcatccccgtctttctg
aactgctggctggccaagcacgcgctggaaaacatgattaatgacttccaccgtgccatc
ctgcggacacagtcagccatgttcaaccaggtcctcatcctcttctgcaccctgctgtgc
ctcgttttcacggggacctgcggcatccagcacctggagcgggcgggcgagaacctgtcc
ctcctgacctccttctacttctgcatcgtcaccttctccaccgtgggctacggtgacgtc
acgcccaagatctggccatcgcagctgctggtggtcatcatgatctgcgtggccctcgtg
gtgctcccactgcagttcgaggagctcgtctacctctggatggagcggcagaagtcaggg
ggcaactacagccgccaccgtgcgcagacggagaagcacgtggtcctgtgtgtcagctcc
ctcaagatcgaccttctcatggacttcctgaacgagttctacgcccacccccggctccag
gactattacgtggtcatcctgtgccccacggagatggatgtccaggtgcgcagagtcctg
cagatccctctgtggtcccagcgggtcatctacctccagggctctgcactcaaagaccag
gacctcatgcgagccaagatggacaatggggaggcctgcttcatcctcagcagcaggaac
gaggtggaccgcacggctgcagaccaccagaccatcctgcgcgcctgggccgtgaaggac
ttcgcccccaactgccccctctacgtccagatcctcaaacctgaaaacaagtttcacgtc
aagtttgctgaccacgtggtgtgtgaggaggagtgcaagtacgccatgctggcgctgaac
tgcatctgcccggcgacctccaccctcatcaccctgctggtgcacacgtcccgcggccag
gagggacaggagtctccggagcagtggcagcgcatgtatgggcgctgctccggcaacgag
gtgtaccacatccgcatgggtgacagcaagttcttccgcgagtacgagggcaagagcttc
acctacgcggccttccacgcccacaagaagtatggcgtgtgcctcatcgggctgaagcgg
gaggacaacaagagcatcctgctgaacccggggccccggcacatcctggccgcctctgac
acctgcttctacatcaacatcaccaaggaggagaactcggccttcatcttcaagcaggag
gagaagcggaagaagagggccttctcggggcaggggctgcacgagggtccggcccgcctg
cccgtgcacagcatcatcgcctccatggggacagtggccatggacctgcagggcacagag
caccggcctacgcagagcggcggtgggggcgggggcagcaagctggcactgcccacggag
aacggctcgggcagccggcggcccagcatcgcgcccgtcctggaactggccgacagctca
gccctgctgccctgcgacctgctgagcgaccagtcggaggatgaggtgacgccgtcggac
gacgaggggctctccgtggtagagtatgtgaagggctaccctcccaactcgccctacatc
ggcagctccccaaccctgtgccacctcctgcctgtgaaagcccccttctgctgcctgcgg
ctggacaagggctgcaagcacaacagctatgaagacgccaaggcctacgggttcaagaac
aagctgatcatcgtctcggcagagacggccggcaatgggctgtacaacttcatcgtgcca
ctgcgggcctactacagatcccgcaaggagctgaaccccatcgtgctgctgctggacaac
aagcccgaccaccacttcctggaagccatctgctgcttccccatggtctactacatggag
ggctctgtggacaacctggacagcctgctgcagtgtggcatcatctatgcggacaacctg
gtggtggtggacaaggagagcaccatgagcgccgaggaggactacatggcggacgccaag
accatcgtcaacgtgcagaccatgttccggctcttccccagcctcagcatcaccacggag
ctcacccacccttccaacatgcgcttcatgcagttccgcgccaaggacagctactctctg
gctctttccaaactagaaaagagggagcgagagaatggctccaacctggccttcatgttc
cgcctgccgttcgccgccggccgcgtcttcagcatcagcatgttggacacactgctctac
cagtccttcgtgaaggactacatgatcaccatcacccggctgctgctgggcctggacacc
acgccgggctcggggtacctctgtgccatgaaaatcaccgagggcgacctgtggatccgc
acgtacggccgcctcttccagaagctctgctcctccagcgccgagatccccattggcatc
taccggacagagagccacgtcttctccacctcggagccccacgacctcagagcccagtcc
cagatctcggtgaacgtggaggactgtgaggacacacgggaagtgaaggggccctggggc
tcccgcgctggcaccggaggcagctcccagggccgccacacgggcggcggtgaccccgca
gagcacccactgctacggcgcaagagcctgcagtgggcccggaggctgagccgcaaggcg
cccaagcaggcaggccgggcggcggccgcggagtggatcagccagcagcgcctcagcctg
taccggcgctctgagcgccaggagctctccgagctggtgaagaaccgcatgaagcacctg
gggctgcccaccaccggctacgacgagatgaacgaccaccagaacaccctctcctacgtc
ctcatcaaccctccgcccgacacgaggctggagcccagtgacattgtctatctcatccgc
tccgaccccctggctcacgtggccagcagctcccagagccggaagagcagctgcagccac
aagctgtcgtcctgcaaccccgagactcgcgacgagacacagctctga

DBGET integrated database retrieval system