KEGG   Homo sapiens (human): 576Help
Entry
576               CDS       T01001                                 

Gene name
ADGRB2, BAI2
Definition
(RefSeq) adhesion G protein-coupled receptor B2
  KO
K04597  
brain-specific angiogenesis inhibitor 2
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Brain-specific angiogenesis inhibitor (BAI)
    576 (ADGRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35
AA seq 1584 aa AA seqDB search
MENTGWMGKGHRMTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDLFPT
IASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
AESEVGRPEEEEAEAAAGLELCSGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAF
RFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFAQPGCSCPGEAGAGSTTTTSPG
PPAAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVKTQWPRSADEP
GLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLRETRPCNNSAT
CPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEG
QWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGP
WNAWSLCSKTCDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEYVM
LMTWKKAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLR
EHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDILRNVTDTFKRATYVPSAD
DVQRFFQVVSFMVDAENKEKWDDAQQVSPGSVHLLRVVEDFIHLVGDALKAFQSSLIVTD
NLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPATSGAA
GSPGRGRGPGTVPPGPGHSHQRLLPADPDESSYFVIGAVLYRTLGLILPPPRPPLAVTSR
VMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDWDTENCQTLETQ
AAHTRCQCQHLSTFAVLAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWRF
IKSERSIILLNFCLSILASNILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQ
SYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAF
VGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKKQRAGSERCPWASLLLPCSACGAVPSP
LLSSASARNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVFNSAQGFVITA
VHCFLRREVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVN
TCNPSTITGTLSRLSLDEDEEPKSCLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQE
ANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSLQPGGGGGGGEDAPRARPEG
TPRRAAKTVAHTEGYPSFLSVDHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGE
RSRTMPRTVPGSTMKMGSLERKKLRYSDLDFEVMHTRKRHSELYHELNQKFHTFDRYRSQ
STAKREKRWSVSSGGAAERSVCTDKPSPGERPSLSQHRRHQSWSTFKSMTLGSLPPKPRE
RLTLHRAAAWEPTEPPDGDFQTEV
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atggagaatacaggttggatgggcaagggacataggatgaccccagcctgtcccctctta
ctgtctgtgattctgtccctgcgcctggccaccgccttcgaccccgcccccagtgcctgc
tctgccctggcctcgggtgtgctctacggggccttctcgctgcaggacctctttcctacc
atcgcctcgggctgctcctggaccctggagaaccctgaccccaccaagtactccctctac
ctgcgcttcaaccgccaggagcaggtgtgcgcacactttgccccccgcctgctgcccctg
gaccactacctggtcaactttacctgcctgcggcctagccccgaggaggcggtggcccag
gcggagtcagaggtggggcggccagaagaggaggaggcagaggcggcagcggggttggag
ctgtgcagcggctcaggcccctttaccttcctgcacttcgacaagaacttcgtgcagctg
tgcctgtcggctgagccctccgaggccccgcgcctgctggcgcccgctgccctagccttc
cgctttgtcgaggtcttgctcatcaacaacaacaactctagccaattcacctgtggtgtg
ctctgccgctggagtgaggagtgtggccgcgctgccggcagggcctgcggctttgctcag
ccaggctgcagctgccctggagaggcgggggccggctccaccaccaccacatctccaggc
cctcctgctgcccacaccctgtccaatgccctggtgcccgggggcccagccccacctgct
gaggccgatttgcactcggggagcagcaatgatctgttcacaaccgagatgagatatggt
gaggagccggaagaggaaccgaaagtgaaaacccagtggccgaggtctgcagatgagcct
gggctatacatggcgcagacaggcgacccggcggctgaggagtggtccccgtggagcgtg
tgttccctgacgtgtgggcagggtctgcaggtgcggacccgctcctgtgtgtcctccccc
tatgggaccctgtgcagcgggcccctgcgggagaccaggccctgcaacaattcagccacc
tgcccagtgcacggcgtgtgggaggagtgggggtcctggagcctgtgctcccgcagctgc
gggcgggggtcccggagccggatgcggacctgcgtgcccccccagcacggcggcaaggcc
tgcgagggtcctgagctgcagactaagctctgcagtatggctgcctgcccggtggaaggc
cagtggttagaatggggtccctggggcccatgctccacgtcctgtgccaatgggacccaa
cagcgcagccggaagtgcagcgtggcgggcccagcctgggccacatgcacgggtgccctc
actgacacccgggagtgcagcaacctcgagtgcccggccactgatagcaagtgggggcca
tggaatgcgtggagcctgtgctctaagacgtgtgacacaggctggcagcgccgcttccgc
atgtgccaggccacgggcacgcagggctacccctgcgagggcaccggagaggaggtgaag
ccttgtagtgagaagaggtgtccagccttccatgagatgtgcagggatgagtacgtgatg
ctgatgacgtggaagaaggcagctgctggcgagatcatctacaacaagtgccccccgaat
gcctcagggtctgccagccgccgctgtctcctcagtgcccaaggcgtggcgtactggggg
ctgcccagctttgctcgctgcatctcccatgagtaccgctacctgtatctgtcacttagg
gagcacctggccaaggggcagcgcatgctggcaggcgagggcatgtcgcaggtggtgcgc
agcctgcaggagctactggcccggcgcacctactatagtggggacctgctcttctctgtg
gacattctgaggaatgtcactgacacctttaagagggccacctacgtgccctcggctgat
gatgtgcagcgcttcttccaggtggtgagcttcatggtggatgcggaaaacaaggagaag
tgggacgatgctcagcaggtgtcccctggctctgtgcacctgctccgtgtcgtggaggac
ttcattcacctggtgggcgatgctctcaaggccttccagagctctctgattgtcacagat
aatctagtgatcagcattcagcgagagcccgtctcagctgtgtccagtgacatcacgttc
cccatgcggggccgccggggcatgaaggactgggtgcggcactcagaggaccgcctcttc
ctgcccaaggaggtgctcagcctctcctccccagggaagccagccacatctggggcagca
ggcagccctggcagggggaggggcccaggaacggtgcctcctggcccaggccactcccac
cagcgcctcctcccagcagaccctgatgagtcctcctactttgtgatcggtgctgtactc
taccgcacccttggcctcatcctgccgcctcccaggcccccgctggccgtcacatcccgg
gtgatgacagtgactgtgcgcccccctacccagcctccagctgagcccctcatcactgtg
gagctctcctacatcatcaatgggaccacggatccccattgcgccagctgggactactcc
agagcagatgccagctcaggagactgggacactgaaaattgccagaccctggagacccag
gcagctcacacccgctgccagtgccagcacctgtccacctttgctgtactagcccagccg
cccaaggacctgaccctggagctggcgggctccccctcggtccccctggtgatcggctgt
gcagtgtcgtgcatggcgctgctcaccctgctcgccatctatgccgccttttggaggttc
ataaaatctgaacgctccatcatcttgctgaacttctgcctgtccatcttggcatccaac
atcctgatcctcgtgggccagtcccgggtgctgagcaagggcgtgtgcaccatgacggct
gccttcctgcacttcttctttctctcctccttttgctgggtgcttaccgaggcctggcag
tcctacctggctgtcattgggcggatgcgcacccgcctcgttcgcaagcgcttcctctgc
ctgggctggggtctgcctgccctggtggtggccgtgtctgttggctttacccgaacgaaa
ggatacggtacatccagctactgctggctctccctggagggcggcctgctctacgccttt
gtgggccctgcagccgtcattgtcctggtgaacatgctcatcggaatcatcgtcttcaac
aagctcatggcacgtgatggcatctccgacaaatccaagaagcagagggccgggtcggag
cggtgcccctgggccagcctgctcctcccctgctcagcgtgtggagcggtccccagcccc
ctgctcagctcagcctcggccaggaacgccatggcctcactctggagctcctgcgtggtg
ctgcccctgctggcgctcacctggatgtctgccgtcctggctatgacagaccgccgttcc
gtcctcttccaggccctctttgctgtcttcaactccgcgcagggctttgtcatcactgct
gtgcactgcttcctgcgccgagaggtccaggatgtggtgaagtgccagatgggggtgtgc
cgggctgatgagagcgaagactcccctgactcgtgtaagaacgggcagctgcagatcctg
tcagactttgaaaaggatgtggatctggcttgtcaaacagtgctgttcaaggaggtcaac
acttgcaacccgtccaccatcacgggcacactatcccgcctgtccctggatgaggatgag
gagcccaagtcctgcctcgtgggccctgagggcagcctcagcttctcaccactgcctggg
aatatcctggtgcccatggcagcctcaccagggctgggggagcctccgcccccacaggag
gccaaccctgtttacatgtgtggggagggtggcctgcggcagctggacctcacatggctg
cggcccactgagccaggctctgagggagactacatggtgctgccccggcggactttgagc
ctgcagcctggcggtgggggtggaggtggtgaggatgcccccagggcccggccggagggg
accccccggcgagctgccaagacagtggcccacactgaaggctaccccagcttcctgtcc
gtggaccactcgggcctggggctgggccctgcctatggatctctccagaatccctatgga
atgaccttccaaccgccaccgccgacacccagcgcccgccaagtgcccgagccaggggag
cgcagccggaccatgcctcgcaccgtgcccggctctaccatgaagatgggctccctggag
cgaaagaaattacggtattcagacctggactttgaggtgatgcacacccggaaacggcat
tcagaactctaccacgagctcaaccagaagttccacactttcgaccgctaccgcagccag
tccacggccaagagggagaagcggtggagtgtgtcctcgggtggggcagccgagcggagc
gtgtgcaccgataagcccagccctggggagcgccccagcttgtcccaacatcggcgccat
cagagctggagcaccttcaaatctatgacactgggctcgctgccccccaagccccgagaa
cggctgactctgcaccgggcagcagcctgggagcccacagaaccaccggatggtgacttc
cagacagaggtgtga

DBGET integrated database retrieval system