KEGG   Homo sapiens (human): 57620Help
Entry
57620             CDS       T01001                                 

Gene name
STIM2
Definition
(RefSeq) stromal interaction molecule 2
  KO
K18196  
stromal interaction molecule 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    57620 (STIM2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   57620 (STIM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p15.2
AA seq 746 aa AA seqDB search
MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPC
FTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHIT
IEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI
SQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKT
SKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEE
ACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHE
VEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGG
VDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSH
PRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSL
NSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVDVSWGSPDCVGLTETK
SMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSI
PHDLCHNGEKSKKPSKIKSLFKKKSK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
ttgctggtgctcgggctgctggtagccggagcggcggacggatgcgagcttgtgccccgg
cacctccgcgggcggcgggcgactggctctgccgcaactgccgcctcctctcccgccgcg
gcggccggcgatagcccggcgctcatgacagatccctgcatgtcactgagtccaccatgc
tttacagaagaagacagatttagtctggaagctcttcaaacaatacataaacaaatggat
gatgacaaagatggtggaattgaagtagaggaaagtgatgaattcatcagagaagatatg
aaatataaagatgctactaataaacacagccatctgcacagagaagataaacatataacg
attgaggatttatggaaacgatggaaaacatcagaagttcataattggacccttgaagac
actcttcagtggttgatagagtttgttgaactaccccaatatgagaagaattttagagac
aacaatgtcaaaggaacgacacttcccaggatagcagtgcacgaaccttcatttatgatc
tcccagttgaaaatcagtgaccggagtcacagacaaaaacttcagctcaaggcattggat
gtggttttgtttggacctctaacacgcccacctcataactggatgaaagattttatcctc
acagtttctatagtaattggtgttggaggctgctggtttgcttatacgcagaataagaca
tcaaaagaacatgttgcaaaaatgatgaaagatttagagagcttacaaactgcagagcaa
agtctaatggacttacaagagaggcttgaaaaggcacaggaagaaaacagaaatgttgct
gtagaaaagcaaaatttagagcgcaaaatgatggatgaaatcaattatgcaaaggaggag
gcttgtcggctgagagagctaagggagggagctgaatgtgaattgagtagacgtcagtat
gcagaacaggaattggaacaggttcgcatggctctgaaaaaggccgaaaaagaatttgaa
ctgagaagcagttggtctgttccagatgcacttcagaaatggcttcagttaacacatgaa
gtagaagtgcaatactacaatattaaaagacaaaacgctgaaatgcagctagctattgct
aaagatgaggcagaaaaaattaaaaagaagagaagcacagtctttgggactctgcacgtt
gcacacagctcctccctagatgaggtagaccacaaaattctggaagcaaagaaagctctc
tctgagttgacaacttgtttacgagaacgactttttcgctggcaacaaattgagaagatc
tgtggctttcagatagcccataactcaggactccccagcctgacctcttccctttattct
gatcacagctgggtggtgatgcccagagtctccattccaccctatccaattgctggagga
gttgatgacttagatgaagacacacccccaatagtgtcacaatttcccgggaccatggct
aaacctcctggatcattagccagaagcagcagcctgtgccgttcacgccgcagcattgtg
ccgtcctcgcctcagcctcagcgagctcagcttgctccacacgccccccacccgtcacac
cctcggcaccctcaccacccgcaacacacaccacactccttgccttcccctgatccagat
atcctctcagtgtcaagttgccctgcgctttatcgaaatgaagaggaggaagaggccatt
tacttctctgctgaaaagcaatgggaagtgccagacacagcttcagaatgtgactcctta
aattcttccattggaaggaaacagtctcctcctttaagcctcgagatataccaaacatta
tctccgcgaaagatatcaagagatgaggtgtccctagaggattcctcccgaggggattcg
cctgtaactgtggatgtgtcttggggttctcccgactgtgtaggtctgacagaaactaag
agtatgatcttcagtcctgcaagcaaagtgtacaatggcattttggagaaatcctgtagc
atgaaccagctttccagtggcatcccggtgcctaaacctcgccacacatcatgttcctca
gctggcaacgacagtaaaccagttcaggaagccccaagtgttgccagaataagcagcatc
ccacatgacctttgtcataatggagagaaaagcaaaaagccatcaaaaatcaaaagcctt
tttaagaagaaatctaagtga

DBGET integrated database retrieval system