KEGG   Homo sapiens (human): 57620Help
Entry
57620             CDS       T01001                                 

Gene name
STIM2
Definition
(RefSeq) stromal interaction molecule 2
  KO
K18196  stromal interaction molecule 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    57620 (STIM2)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   57620 (STIM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOAR SAM_2 SAM_1 Ste50p-SAM ESSS DUF4446
Motif
Other DBs
NCBI-GeneID: 57620
NCBI-ProteinID: NP_065911
OMIM: 610841
HGNC: 19205
Ensembl: ENSG00000109689
Vega: OTTHUMG00000097805
Pharos: Q9P246(Tbio)
UniProt: Q9P246 B3KUB5
Structure
PDB: 

Jmol
Position
4p15.2
AA seq 746 aa AA seqDB search
MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPC
FTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHIT
IEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI
SQLKISDRSHRQKLQLKALDVVLFGPLTRPPHNWMKDFILTVSIVIGVGGCWFAYTQNKT
SKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVAVEKQNLERKMMDEINYAKEE
ACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDALQKWLQLTHE
VEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGG
VDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSH
PRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSL
NSSIGRKQSPPLSLEIYQTLSPRKISRDEVSLEDSSRGDSPVTVDVSWGSPDCVGLTETK
SMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSSAGNDSKPVQEAPSVARISSI
PHDLCHNGEKSKKPSKIKSLFKKKSK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
ttgctggtgctcgggctgctggtagccggagcggcggacggatgcgagcttgtgccccgg
cacctccgcgggcggcgggcgactggctctgccgcaactgccgcctcctctcccgccgcg
gcggccggcgatagcccggcgctcatgacagatccctgcatgtcactgagtccaccatgc
tttacagaagaagacagatttagtctggaagctcttcaaacaatacataaacaaatggat
gatgacaaagatggtggaattgaagtagaggaaagtgatgaattcatcagagaagatatg
aaatataaagatgctactaataaacacagccatctgcacagagaagataaacatataacg
attgaggatttatggaaacgatggaaaacatcagaagttcataattggacccttgaagac
actcttcagtggttgatagagtttgttgaactaccccaatatgagaagaattttagagac
aacaatgtcaaaggaacgacacttcccaggatagcagtgcacgaaccttcatttatgatc
tcccagttgaaaatcagtgaccggagtcacagacaaaaacttcagctcaaggcattggat
gtggttttgtttggacctctaacacgcccacctcataactggatgaaagattttatcctc
acagtttctatagtaattggtgttggaggctgctggtttgcttatacgcagaataagaca
tcaaaagaacatgttgcaaaaatgatgaaagatttagagagcttacaaactgcagagcaa
agtctaatggacttacaagagaggcttgaaaaggcacaggaagaaaacagaaatgttgct
gtagaaaagcaaaatttagagcgcaaaatgatggatgaaatcaattatgcaaaggaggag
gcttgtcggctgagagagctaagggagggagctgaatgtgaattgagtagacgtcagtat
gcagaacaggaattggaacaggttcgcatggctctgaaaaaggccgaaaaagaatttgaa
ctgagaagcagttggtctgttccagatgcacttcagaaatggcttcagttaacacatgaa
gtagaagtgcaatactacaatattaaaagacaaaacgctgaaatgcagctagctattgct
aaagatgaggcagaaaaaattaaaaagaagagaagcacagtctttgggactctgcacgtt
gcacacagctcctccctagatgaggtagaccacaaaattctggaagcaaagaaagctctc
tctgagttgacaacttgtttacgagaacgactttttcgctggcaacaaattgagaagatc
tgtggctttcagatagcccataactcaggactccccagcctgacctcttccctttattct
gatcacagctgggtggtgatgcccagagtctccattccaccctatccaattgctggagga
gttgatgacttagatgaagacacacccccaatagtgtcacaatttcccgggaccatggct
aaacctcctggatcattagccagaagcagcagcctgtgccgttcacgccgcagcattgtg
ccgtcctcgcctcagcctcagcgagctcagcttgctccacacgccccccacccgtcacac
cctcggcaccctcaccacccgcaacacacaccacactccttgccttcccctgatccagat
atcctctcagtgtcaagttgccctgcgctttatcgaaatgaagaggaggaagaggccatt
tacttctctgctgaaaagcaatgggaagtgccagacacagcttcagaatgtgactcctta
aattcttccattggaaggaaacagtctcctcctttaagcctcgagatataccaaacatta
tctccgcgaaagatatcaagagatgaggtgtccctagaggattcctcccgaggggattcg
cctgtaactgtggatgtgtcttggggttctcccgactgtgtaggtctgacagaaactaag
agtatgatcttcagtcctgcaagcaaagtgtacaatggcattttggagaaatcctgtagc
atgaaccagctttccagtggcatcccggtgcctaaacctcgccacacatcatgttcctca
gctggcaacgacagtaaaccagttcaggaagccccaagtgttgccagaataagcagcatc
ccacatgacctttgtcataatggagagaaaagcaaaaagccatcaaaaatcaaaagcctt
tttaagaagaaatctaagtga

DBGET integrated database retrieval system