KEGG   Homo sapiens (human): 57636Help
Entry
57636             CDS       T01001                                 

Gene name
ARHGAP23
Definition
(RefSeq) Rho GTPase activating protein 23
  KO
K20315  
Rho GTPase-activating protein 21/23
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
17q12
AA seq 1491 aa AA seqDB search
MNGVAFCLVGIPPRPEPRPPQLPLGPRDGCSPRRPFPWQGPRTLLLYKSPQDGFGFTLRH
FIVYPPESAVHCSLKEEENGGRGGGPSPRYRLEPMDTIFVKNVKEDGPAHRAGLRTGDRL
VKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEAR
SIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLRVPPAARAHL
DNSSLGMSQPRPSPGAFPHLSSEPRTPRAFPEPGSRVPPSRLECQQALSHWLSNQVPRRA
GERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRATR
SAEALGPGALVSPRFERCGWASQRSSARTPACPTRDLPGPQAPPPSGLQGLDDLGYIGYR
SYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPASFPPEASEPPRVVRPEPSTRALEP
PAEDRGDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEASGRGERLGRKVAPLATTE
DSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQD
CSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSL
DSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQILTKKGKKAGSGLRQWKRVYA
ALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTT
ADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPKA
DSSPKGSRGLGGLKSEFLKQSAARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKAAP
RAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRG
PGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDARERMRTLRKL
IRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMP
DRYKIVETLIQHSDWFFSDEEDKGERTPVGDKEPQAVPNIEYLLPNIGRTVPPGDPGSDS
TTCSSAKSKGSWAPKKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKP
GAGATAPGTQERPQGPLPGAVAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMDRSV
CSGASGRRAGAGDEADDERSELSHVETDTEGAAGAGPGGRLTRRPSFSSHHLMPCDTLAR
RRLARGRPDGEGAGRGGPRAPEPPGSASSSSQESLRPPAAALASRPSRMEALRLRLRGTA
DDMLAVRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPPEPAGARAHS
DNKDSGLSSLESTKARAPSSAASQPPAPGDTGSLQSQPPRRSAASRLHQCL
NT seq 4476 nt NT seq  +upstreamnt  +downstreamnt
atgaatggagtcgccttctgcctggtcgggatcccgccccgcccggagccccggccccca
cagctgccactgggcccaagagatgggtgctctcctaggcgccccttcccctggcagggg
ccgaggacgctgctgctgtacaaaagtccccaggacggctttggcttcactctgcgccac
ttcatcgtgtacccacccgagtcggccgtgcactgcagcctgaaggaggaagagaatgga
ggccgtggaggaggaccctccccccggtaccgcctggagcccatggacaccatctttgtc
aagaatgtgaaggaagacggccctgcccatagggcggggcttcgcacaggagaccggctg
gtaaaggtgaatggggaaagcgtcattgggaagacctactctcaggtcatagctctgatc
cagaatagtgatgacactctggagctgtctatcatgcccaaggacgaggacatcctccag
ctggcctactcccaggatgcctacctgaaagggaacgagccgtattctggagaggcccgc
agcatcccagagccaccgccgatctgctacccccgcaagacctacgcccctcctgcccgg
gcctccaccagggccactatggtgcctgagcccacctcagcactgcccagtgacccccgg
agtcctgctgcctggagtgacccggggctccgtgtgccacctgctgcccgtgcccacctg
gacaactcttccttggggatgagccagccccgccccagccctggtgccttcccccacctc
tcctcggagccccggacgccccgtgccttcccagagcctggcagccgggtgccccccagc
agactggagtgccagcaggccttgtcacactggctgtcaaaccaggtaccccgccgggcg
ggggagagacggtgcccagccatggccccccgggcccgcagcgcctcccaggaccggttg
gaggaggtggctgccccccgcccgtggccctgctccacctcccaggatgctttgagccag
ctgggccaggagggctggcaccgagctcgctcagatgactacttgagccgggccacccgt
tctgccgaggcactggggccaggggcactggtgtcaccccgctttgagcggtgtggctgg
gcttcccagcgttcgtctgcccgcacccccgcctgcccaactcgggacctgccagggccc
caggccccacccccgtctggcctgcagggcctggatgacctcgggtacatcggctaccgg
agctacagcccatcattccagcgccggaccggcctcctccatgcgctctccttccgggac
tcaccctttggggggctgcctaccttcaacctggcccagtcccctgcgtcattcccacca
gaggcctccgagccacccagggttgtacggccggaacccagcacccgggccctggagcct
cctgcggaggatcgcggcgatgaggtggtcctgaggcagaagcccccgacgggccgcaag
gttcagctgacccccgcaagacagatgaaccttggatttggtgacgagtccccagagcca
gaggccagtgggcgaggggaacgcctgggcaggaaggtggcccctttggccaccaccgaa
gactctctggcttccatcccctttattgatgagcccaccagccccagcattgacctccaa
gccaagcacgtccctgcctctgctgtggtctccagtgccatgaactcagcccctgtcctg
ggcaccagcccatcttccccgaccttcactttcaccctcggacgccattactcgcaggac
tgcagcagcatcaaggctggccgccgctcctcctacctgctggccatcaccacggagcgc
tccaagtcctgcgatgatggactcaacaccttccgcgacgagggccgggttctgcggcgc
ctgccaaaccgcatacccagcctgcggatgctccggagcttcttcaccgacgggtccttg
gatagctggggcacctctgaagatgctgacgctccttctaagcgacactcaacctctgac
ctctcagatgcgaccttcagcgatatcaggagagaaggctggttgtattataagcagatt
ctcaccaagaaggggaagaaagcgggcagcggcctgcgccagtggaagcgggtgtacgcc
gcgctgcgggcgcgctcgctctcgctgagcaaggagcggcgggagcccgggccggcggcg
gcgggggctgcggcggccggcgcaggtgaggacgaggcggcgcccgtctgcatcggctcc
tgcctcgtggacatctcctacagcgagaccaagaggaggcacgtgttccggctgaccacc
gctgacttctgtgaatatctctttcaggctgaggaccgggatgacatgctgggctggatc
agagcgatccgggagaacagcagggccgagggcgaggaccccggctgtgccaaccaagct
ctgatcagcaagaagcttaacgattatcgcaaagtgagccatagctctgggcccaaagct
gattcctcccccaaaggctctcgcggcctggggggcctcaagtctgagttcctcaagcag
agtgcggcacgtggcctcaggactcaggacctgcccgcagggagcaaggatgacagtgct
gcagcccccaaaaccccctggggcatcaacatcatcaagaaaaataagaaggccgctccg
agggcgtttggggtcaggctggaggagtgccagccagccacggagaaccagcgcgtcccc
ttaatcgtggctgcatgctgtcgcattgtggaggcacgagggctggagtccacaggcatt
taccgagtgcccggcaacaatgcagtggtgtccagcctacaggagcagctcaaccgcggg
cctggtgacatcaacctgcaggatgagcgctggcaagacctcaatgtgatcagcagcctg
ctcaagtccttcttccgaaagctgcccgagcctcttttcactgatgacaaatacaacgac
ttcatcgaggccaaccgcattgaggacgcgcgggagcgaatgaggacgctgcggaagctg
atccgggatctcccaggacactactatgaaacgctcaaattccttgtgggccatctcaag
accatcgctgaccactctgagaaaaacaagatggaaccccggaacctggccctggtcttt
gggccgacactggtgaggacgtctgaggacaacatgacagacatggtgacccacatgcct
gaccgctacaagatcgtggagacactgatccagcactcagactggttcttcagtgacgaa
gaggacaagggagagagaacccctgtgggcgacaaggagcctcaggcagtgcccaacatt
gagtacctcctgcccaacattggcaggacagtgccccctggcgacccggggtcagattct
accacctgtagttcagccaagtccaagggttcgtgggcccccaagaaggagccgtacgcc
cgggagatgctggcgatctccttcatctcggccgtcaaccgcaagcgcaagaagcggcgg
gaggcgcgggggctgggcagcagcaccgacgacgactcggagcaggaggcgcacaagcct
ggggcgggggccacagcgccggggactcaggagcggccgcaggggccgctgcctggcgcc
gtcgcccccgaggcccccggacgcctcagtcccccggcggcgccggaggagcggccggcc
gcggacacgcgctccattgtgtcgggctactccaccctgtccaccatggaccgcagcgtg
tgctcgggcgctagcggtcggcgggcaggggcgggggatgaggcggacgacgagcgtagc
gagctgagccacgtggagacggacactgagggcgcggcgggcgcggggcctggggggcgc
ctgacacgccggccgtccttcagctcgcaccacctcatgccctgcgacactctggcgcgc
cgccgcctggcccggggccgcccagacggcgagggcgcgggccggggcggtccccgcgcc
ccggagccgcccggctcggcgtcgtccagcagccaggagtcgctgcggcccccggcggcg
gcgctggcctcccggccctcgcgcatggaggcgctgcgtctaaggctccgcggcacggcg
gacgacatgctcgccgtgcgcctgcggcggccgctgtcgcccgagacccggcggcgccgg
agcagctggcgccgccacaccgtggtggtgcagagcccgctgactgacctcaacttcaac
gagtggaaggagctgggcggagggggccccccggagcctgcgggcgcgcgggcgcacagt
gacaacaaggactccggactcagcagcctggagtccaccaaggcgcgggccccgtcgtcc
gctgcctcgcagccgcccgcgcccggggacacggggtccctgcagagccagcccccgcgc
cgctcggccgcctcccgcctgcatcagtgtctgtga

DBGET integrated database retrieval system