KEGG   Homo sapiens (human): 57644Help
Entry
57644             CDS       T01001                                 

Gene name
MYH7B, MHC14, MYH14
Definition
myosin, heavy chain 7B, cardiac muscle, beta
Orthology
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    57644 (MYH7B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   57644 (MYH7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.22
AA seq 1983 aa AA seqDB search
MSGNKRGSRASCPHRGAECLLPWAALNLQGFQLLLLHPSATAMMDVSELGESARYLRQGY
QEMTKVHTIPWDGKKRVWVPDEQDAYVEAEVKSEATGGRVTVETKDQKVLMVREAELQPM
NPPRFDLLEDMAMMTHLNEASVLHNLRQRYARWMIYTYSGLFCVTINPYKWLPVYTASVV
AAYKGKRRSDSPPHIYAVADNAYNDMLRNRDNQSMLITGESGAGKTVNTKRVIQYFAIVA
ALGDGPGKKAQFLATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPS
GKLASADIDSYLLEKSRVIFQLPGERSYHVYYQILSGRKPELQDMLLLSMNPYDYHFCSQ
GVITVDNMNDGEELIATDHAMDILGFSVDEKCACYKIVGALLHFGNMKFKQKQREEQAEA
DGTESADKAAYLMGVSSGDLLKGLLHPRVRVGNEYVTKGQSVEQVVFAVGALAKATYDRL
FRWLVSRINQTLDTKLPRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNQHMFV
LEQEEYKREGIDWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDASFRAKLYDN
HAGKSPNFQQPRPDKKRKYQAHFEVVHYAGVVPYSIVGWLEKNKDPLNETVVPIFQKSQN
RLLATLYENYAGSCSTEPPKSGVKEKRKKAASFQTVSQLHKENLNKLMTNLRATQPHFVR
CIVPNENKTPGVMDAFLVLHQLRCNGVLEGIRICRQGFPNRLLYTDFRQRYRILNPSAIP
DDTFMDSRKATEKLLGSLDLDHTQYQFGHTKVFFKAGLLGVLEELRDQRLAKVLTLLQAR
SRGRLMRLEYQRLLGGRDALFTIQWNIRAFNAVKNWSWMKLFFKMKPLLRSAQAEEELAA
LRAELRGLRGALAAAEAKRQELEETHVSITQEKNDLALQLQAEQDNLADAEERCHLLIKS
KVQLEGKVKELSERLEDEEEVNADLAARRRKLEDECTELKKDIDDLELTLAKAEKEKQAT
ENKVKNLTEEMAALDESVARLTKEKKALQEAHQQALGDLQAEEDRVSALTKAKLRLEQQV
EDLECSLEQEKKLRMDTERAKRKLEGDLKLTQESVADAAQDKQQLEEKLKKKDSELSQLS
LRVEDEQLLGAQMQKKIKELQARAEELEEELEAERAARARVEKQRAEAARELEELSERLE
EAGGASAGQREGCRKREAELGRLRRELEEAALRHEATVAALRRKQAEGAAELGEQVDSLQ
RVRQKLEKEKSELRMEVDDLAANVETLTRAKASAEKLCRTYEDQLSEAKIKVEELQRQLA
DASTQRGRLQTESGELSRLLEEKECLISQLSRGKALAAQSLEELRRQLEEESKAKSALAH
AVQALRHDCDLLREQHEEEAEAQAELQRLLSKANAEVAQWRSKYEADAIQRTEELEEAKK
KLALRLQEAEEGVEAANAKCSSLEKAKLRLQTESEDVTLELERATSAAAALDKKQRHLER
ALEERRRQEEEMQRELEAAQRESRGLGTELFRLRHGHEEALEALETLKRENKNLQEEISD
LTDQVSLSGKSIQELEKTKKALEGEKSEIQAALEEAEGALELEETKTLRIQLELSQVKAE
VDRKLAEKDEECANLRRNHQRAVESLQASLDAETRARNEALRLKKKMEGDLNDLELQLGH
ATRQATEAQAATRLMQAQLKEEQAGRDEEQRLAAELHEQAQALERRASLLAAELEELRAA
LEQGERSRRLAEQELLEATERLNLLHSQNTGLLNQKKKLEADLAQLSGEVEEAAQERREA
EEKAKKAITDAAMMAEELKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQ
VQKLEAKVRELEAELDAEQKKHAEALKGVRKHERRVKELAYQAEEDRKNLARMQDLVDKL
QSKVKSYKRQFEEAEQQANTNLAKYRKAQHELDDAEERADMAETQANKLRARTRDALGPK
HKE
NT seq 5952 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaataaaaggggtagcagagcttcctgccctcaccgtggtgccgagtgcctg
ctgccttgggccgccttgaacctccagggtttccagctcctcctccttcaccccagtgcc
actgccatgatggatgtgagtgaacttggggagtctgcccgctacctccgccagggctac
caggagatgacgaaggtgcacactatcccatgggacgggaagaagcgagtctgggtgcct
gatgaacaggacgcctacgtggaggccgaggtcaagtcggaggctaccgggggcagagtc
accgtggagaccaaagaccagaaggtgctgatggtgcgtgaagccgagctgcagcccatg
aacccgcctcgcttcgacttactggaggacatggccatgatgacgcacctgaacgaggcc
tctgtgctgcacaacctgcgccagcgctatgcccgctggatgatctatacctactcaggc
ctcttctgtgtcaccatcaacccctacaaatggctcccagtctatacggcctccgtagtg
gctgcttacaagggaaagcgccgctcagattccccgccccatatatatgcggtggcggac
aacgcctacaacgacatgctgcgcaaccgagacaaccagtccatgctgatcaccggagag
tcgggggccggtaagacggttaacaccaagcgggtcattcagtactttgccatcgtcgct
gccctgggagacgggccgggcaagaaggcccaatttctggcaacaaagacggggggcacc
cttgaggatcaaatcatcgaggccaaccctgccatggaggcctttggcaacgccaagacc
ctgaggaatgataactcctcccgctttggcaagttcatccgcattcactttggtccctct
gggaagctggcatccgcggatattgacagctatctcctggagaagtcgcgggtgatcttc
cagttgcctggtgagcgcagctaccatgtctactaccagatcctctcagggaggaagcca
gagctgcaggacatgctgcttctgtctatgaacccctatgactaccacttctgcagccag
ggcgtcatcaccgtggacaacatgaatgatggggaggagctcatcgccaccgaccatgcc
atggacatcctaggcttcagcgtggatgagaaatgtgcctgctataagatcgtgggcgcc
ctcctgcactttggcaacatgaagttcaagcagaagcagcgggaggagcaggcggaggcc
gatggcactgagagtgctgacaaggctgcctacctgatgggggtcagcagtggggacctc
ctcaaaggccttttgcacccccgggtgcgtgtagggaacgagtacgtgaccaagggccag
agtgtggagcaggtggtgtttgctgtgggggctctggccaaggccacctatgaccggctg
ttcaggtggctggtgtctcggatcaaccagaccctggacacaaagctgccccggcagttc
ttcatcggggttctggacatcgctgggtttgagatctttgagttcaacagcttcgaacag
ctgtgcatcaacttcaccaatgagaaattgcagcagttcttcaaccagcacatgtttgtg
ctggagcaggaggagtacaagcgggagggcatcgactgggtcttcatcgacttcggcctt
gacctgcagccttgcatcgacctcatcgagaagccactgggcatcctgtccatcctggag
gaggaatgcatgttccccaaggcctcagacgccagcttccgggccaagctctacgacaac
cacgcggggaagtcacccaatttccagcagcctcggcctgacaagaagcgcaagtaccag
gcccacttcgaggtggtccactacgcaggcgtggtgccttacagcattgtgggctggctg
gagaaaaacaaggatcccctgaatgagaccgtggtccccatcttccagaagtcacagaat
aggctcctggcgactctctatgagaattatgcgggctcctgctccactgagccccccaag
tctggggtgaaagagaagcgtaagaaggcagcatcgttccagacggtgtcccagctgcac
aaggagaacctcaacaagctgatgaccaacctgcgggccacacagccccacttcgtccgc
tgcattgtccccaacgagaacaaaaccccaggggtcatggatgccttcttggtgctacac
cagctgcgctgcaatggggtcctggaggggatccggatctgccgccaagggttccccaac
aggttgctctacaccgacttccggcagcggtaccgtatcctgaaccccagtgccatcccg
gatgacaccttcatggacagcaggaaggccacagagaaactgctgggctcgctggacttg
gatcacacccagtaccagtttggccacaccaaggtgttcttcaaggctgggcttctaggc
gtcctggaagagctccgtgaccagcgcctggccaaggtgctgacgctgctgcaggcgcgg
agccgtggccgcctcatgcgccttgagtaccagcgcctgctgggaggcagggatgcgctg
ttcaccatccagtggaacatccgtgccttcaatgccgtcaagaactggtcatggatgaag
ctctttttcaagatgaagccgctgctgcgctcggcgcaggctgaggaggagctggcggcc
ctgcgggcagagctgcgggggttgcgaggggcgctggctgcggccgaggccaagcgccag
gaactggaggagacgcacgtcagcatcacccaggagaagaatgacctggccctgcagctg
caggctgagcaggacaacctggcagatgccgaggagcgctgccacttgctgatcaagtcc
aaggtgcagctggaggggaaggtgaaggagctgagtgagcggctggaggatgaggaggag
gtgaacgctgacctggccgcccgccggcgcaagctggaggacgagtgcacggagctcaag
aaggacattgatgacctggagctgacactggccaaagctgagaaggagaagcaagccact
gagaacaaggtgaagaacctgacggaagagatggctgcgctggacgagtcagtggcccgg
ctgaccaaggagaagaaggcgttgcaggaggcccaccaacaggccctgggtgacctgcag
gccgaggaggaccgtgtgagcgcgctgaccaaggccaagctccggctggagcaacaggtg
gaggacctggaatgctccctggagcaggagaagaagctgcgcatggacacggagcgggcc
aagcgcaagctggagggtgacctgaagctgacgcaggagtcggtggctgatgctgctcaa
gacaagcagcagctggaggagaagctcaagaagaaggactccgagctgagccagctgagc
ctgcgggtggaagacgagcagctcttgggggcccagatgcagaagaagatcaaggagctg
caggctcgggcggaggagctggaagaggagctggaggcagagcgggcagcccgggcccgc
gtggagaagcagcgtgcagaggcggcgcgggagctggaggagctgagcgagcggctggag
gaggcaggcggcgcatccgcggggcagcgcgagggctgccgcaagcgggaggcggagctg
gggaggctgcggcgggagctggaggaggcggcgctgcggcacgaggccacagtggcggca
ctgcggcgcaagcaggcggagggcgcggcggagctgggggagcaggtggacagcctgcag
cgggtgcggcagaagctggagaaggagaagagtgagctgcgcatggaggtggacgacctg
gctgccaacgtggagactctgacccgcgccaaggccagtgcagagaagctgtgccggacc
tatgaggatcagctaagcgaggccaagatcaaggtggaggagctgcagcggcagctggcg
gacgcaagcacgcagcgtgggcgactacagacggaaagcggggagctgagtcgcctgcta
gaggagaaggagtgtctgatcagtcagctgagccgtggaaaggccctggccgcccaaagc
ctggaagagttgcggcgccagctagaggaggaaagcaaggccaagagtgccctggcccac
gccgtgcaggctctgcggcacgactgtgacctcctgcgggagcaacacgaggaggaggct
gaggcccaggctgagctgcagcggctgctgtccaaggccaatgccgaggtggcccagtgg
aggagcaagtacgaagcagatgccatccagaggaccgaggagctggaggaggccaaaaaa
aagctggcactgcggctgcaggaggcagaggagggcgtggaggctgccaacgccaagtgc
tcatcgttggagaaggccaagctgcggctacagacagagtcagaggatgtaaccctggag
ctggagcgggcgacctcagcagctgctgcgctggacaagaagcagcggcacttggaacgg
gcactggaggaacggcggcggcaggaggaggagatgcagcgggagctggaggcggcacag
agggagtcccgtggcctgggcaccgagctcttccggctgcggcacggccacgaggaggca
cttgaagccctggagacgctcaagcgggagaacaagaacctgcaggaggagatcagcgac
ctcacagaccaggtgagtctcagtgggaagagcatccaggaactggagaaaaccaagaag
gcgctggaaggcgagaagagtgagatccaggctgcactggaggaggcagagggggccctg
gagctggaggagaccaagacgctgcggatccagctggagctctcccaggtcaaagcagaa
gtggaccggaagctggcagagaaagacgaggagtgcgctaacctgaggcgcaaccaccag
cgagctgtggagtccctgcaggcctccctggatgcagagacacgggcccgcaatgaggcg
ctgcggctcaagaagaagatggagggtgacctcaacgacctggagctgcagctgggccat
gccacccgtcaggccacagaggcccaggctgccacgcggctgatgcaggcacagctcaag
gaggagcaggcagggcgggacgaggagcagcggctggcagctgagctccacgagcaggcg
caggctctggagcgccgggcctcgctgctggctgcggagctggaggagctgcgggctgcc
ctggagcagggcgagcgcagccggcgactggcagagcaggagcttttggaggccaccgag
cgcctcaaccttctgcattcgcagaacacaggcctcctaaaccagaagaagaagctggag
gcggacttggcccagctgagcggggaggtggaggaggctgcacaggagaggcgggaggct
gaggagaaggccaaaaaggccatcactgatgcggccatgatggccgaggagctgaagaag
gagcaggacacaagtgcacacctggaacggatgaagaagacgctggagcagacggtgcgc
gagctccaggcccgccttgaggaggcagaacaggccgccctccgtggcgggaagaagcag
gtgcagaagctggaggccaaggtacgggagctggaggctgagcttgatgcagagcagaag
aagcacgccgaggcccttaagggcgtgcgcaagcatgagcgccgtgtcaaggagctcgca
taccaggccgaggaggacaggaagaacctggctcgcatgcaggacctggtggacaagctg
cagagcaaggtcaagagctacaagcgccagtttgaggaggcggagcagcaggccaacacc
aacctggccaagtatcgcaaggcccagcacgagctggatgatgcggaggagcgggcagac
atggcggaaacccaggccaacaagctgcgggcacggacccgggacgccctgggccccaag
cacaaggagtga

DBGET integrated database retrieval system