KEGG   Homo sapiens (human): 57654Help
Entry
57654             CDS       T01001                                 

Gene name
UVSSA, KIAA1530, UVSS3
Definition
UV-stimulated scaffold protein A
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 709 aa AA seqDB search
MDQKLSKLVEELTTSGEPRLNPEKMKELKKICKSSEEQLSRAYRLLIAQLTQEHAEIRLS
AFQIVEELFVRSHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGW
NEKFGEAYKKLALGYHFLRHNKKVDFQDTNARSLAERKREEEKQKHLDKIYQERASQAER
EMQEMSGEIESCLTEVESCFRLLVPFDFDPNPETESLGMASGMSDALRSSCAGQVGPCRS
GTPDPRDGEQPCCSRDLPASAGHPRAGGGAQPSQTATGDPSDEDEDSDLEEFVRSHGLGS
HKYTLDVELCSEGLKVQENEDNLALIHAARDTLKLIRNKFLPAVCSWIQRFTRVGTHGGC
LKRAIDLKAELELVLRKYKELDIEPEGGERRRTEALGDAEEDEDDEDFVEVPEKEGYEPH
IPDHLRPEYGLEAAPEKDTVVRCLRTRTRMDEEVSDPTSAAAQLRQLRDHLPPPSSASPS
RALPEPQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEV
VNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRP
LDPEDRAREQRRQLQKQERPEWQDPELMRDVEAATGQDLGSSRYSGKGRGKKRRYPSLTN
LKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKFSNQFNYALN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaaactttcgaagttggtagaagagctcacaacttcaggagaaccccgacta
aatcctgagaaaatgaaggaactgaagaaaatttgcaagtcttcagaggagcagctgagc
cgcgcctaccgcctgctgatagcacagctgacccaggagcacgccgagatccgtctctca
gccttccagattgtggaggaactcttcgtcaggtctcaccagttccggatgctggttgtt
tccaacttccaggagttcctggagctcacgctgggcacagaccccgcacagcctctgccg
ccccccagggaggcggcacagaggctgaggcaggcgaccacccgggccgtggaagggtgg
aatgagaagtttggggaggcctacaagaagcttgccttgggctaccacttcttaagacac
aacaaaaaggtggattttcaagacacgaatgctcggagtctggcagaaaggaagagagaa
gaggagaagcagaagcacttggataaaatttatcaagaaagagccagccaggcggagagg
gagatgcaagaaatgtctggagaaattgaatcctgcttgacggaggtagagagctgcttt
aggctgctggtgccttttgactttgacccgaacccggagacggaatcccttggcatggct
tctggcatgtccgatgcccttcgctcctcctgcgcgggccaggtgggcccctgccggtct
ggcacccctgacccccgggacggggagcagccctgctgcagtagagacctgcctgcctct
gcaggccaccccagagcgggcggcggggcacagccatcccagacagccacaggtgacccc
tcagatgaggacgaggacagcgacctcgaggagtttgtgcggagccacgggctgggctcg
cacaagtacacgctggatgtggagctctgctcagagggcctgaaggtgcaggagaacgag
gacaaccttgctctcatccacgccgcccgcgacacactcaagctcatccggaacaagttc
ctgccggctgtgtgctcgtggatccagcgcttcacccgcgtcgggacccacggtggatgt
ttaaagcgtgccattgacctgaaggctgaattggagctcgtactgagaaaatacaaggag
ctggacatcgagcctgagggaggggaaaggcgcaggacagaagccctgggggatgcggag
gaagatgaggacgatgaggactttgtggaggtccctgagaaggaggggtatgagccacac
atccccgaccacttgcggcctgagtatgggctggaggcagcaccagagaaagacacagtt
gtgcggtgcttgcggacgaggacgaggatggacgaggaggtgtcggaccccacctctgcg
gctgctcagctgcggcagctccgggaccacttgcctccaccctcatctgccagcccctcc
agagcgttgccagagccacaggaggcccagaagctggcagcagagcgggcccgggcgcct
gtggtgccctacggcgtggacctgcactactggggccaggagctccccacagccgggaag
attgtcaagtctgactcccagcaccgcttctggaagcccagcgaggtggaggaggaagtg
gtcaatgccgacatctccgagatgctccggagccgccacatcacttttgccgggaagttt
gagcctgtgcagcactggtgccgtgccccgaggccagacggccggctctgtgagcgccaa
gaccggctgaagtgccctttccatgggaagattgttccacgggacgacgaaggacggccg
ctcgacccggaagacagggctcgtgagcagcggcggcagctgcagaagcaggagcgcccg
gaatggcaggaccctgagttgatgagagacgtggaagcagccacagggcaggatctcggc
tcatccaggtacagcgggaaaggcagggggaagaagaggaggtaccccagcctcaccaac
ctgaaggctcaggctgataccgcccgcgctcgcattgggagaaaagtcttcgccaaggca
gctgtgcggagggtagtggcagccatgaaccggatggaccagaagaagcacgagaagttt
tcaaaccagtttaactacgcactgaactag

DBGET integrated database retrieval system