KEGG   Homo sapiens (human): 57680Help
Entry
57680             CDS       T01001                                 

Gene name
CHD8, AUTS18, HELSNF1
Definition
(RefSeq) chromodomain helicase DNA binding protein 8 (EC:3.6.4.12)
  KO
K04494  
chromodomain helicase DNA binding protein 8 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    57680 (CHD8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     57680 (CHD8)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    57680 (CHD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 2581 aa AA seqDB search
MADPIMDLFDDPNLFGLDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGN
SSASELVPPPEETAPTELSKESTAPAPESITLHDYTTQPASQEQPAQPVLQTSTPTSGLL
QVSKSQEILSQGNPFMGVSATAVSSSSAGGQPPQSAPKIVILKAPPSSSVTGAHVAQIQA
QGITSTAQPLVAGTANGGKVTFTKVLTGTPLRPGVSIVSGNTVLAAKVPGNQAAVQRIVQ
PSRPVKQLVLQPVKGSAPAGNPGATGPPLKPAVTLTSTPTQGESKRITLVLQQPQSGGPQ
GHRHVVLGSLPGKIVLQGNQLAALTQAKNAQGQPAKVVTIQLQVQQPQQKIQIVPQPPSS
QPQPQQPPSTQPVTLSSVQQAQIMGPGQSPGQRLSVPVKVVLQPQAGSSQGASSGLSVVK
VLSASEVAALSSPASSAPHSGGKTGMEENRRLEHQKKQEKANRIVAEAIARARARGEQNI
PRVLNEDELPSVRPEEEGEKKRRKKSAGERLKEEKPKKSKTSGASKTKGKSKLNTITPVV
GKKRKRNTSSDNSDVEVMPAQSPREDEESSIQKRRSNRQVKRKKYTEDLDIKITDDEEEE
EVDVTGPIKPEPILPEPVQEPDGETLPSMQFFVENPSEEDAAIVDKVLSMRIVKKELPSG
QYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLKRFKTKMAQMRHFFHEDEEPFN
PDYVEVDRILDESHSIDKDNGEPVIYYLVKWCSLPYEDSTWELKEDVDEGKIREFKRIQS
RHPELKRVNRPQASAWKKLELSHEYKNRNQLREYQLEGVNWLLFNWYNRQNCILADEMGL
GKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFNTWTEMNTIVYHGSLASRQMIQ
QYEMYCKDSRGRLIPGAYKFDALITTFEMILSDCPELREIEWRCVIIDEAHRLKNRNCKL
LDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSQFPSESEFLKDFGDLKTEEQVQK
LQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLSKGAGHTN
MPNLLNTMMELRKCCNHPYLINGAEEKILTEFREACHIIPHDFHLQAMVRSAGKLVLIDK
LLPKLKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDS
DRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITR
NSYEREMFDKASLKLGLDKAVLQSMSGRDGNITGIQQFSKKEIEDLLRKGAYAAIMEEDD
EGSKFCEEDIDQILLRRTTTITIESEGKGSTFAKASFVASENRTDISLDDPNFWQKWAKK
ADLDMDLLNSKNNLVIDTPRVRKQTRHFSTLKDDDLVEFSDLESEDDERPRSRRHDRHHA
YGRTDCFRVEKHLLVYGWGRWRDILSHGRFKRRMTERDVETICRAILVYCLLHYRGDENI
KGFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVKSQSTFDIHKADWIRKYNPDTL
FQDESYKKHLKHQCNKVLLRVRMLYYLRQEVIGDQAEKVLGGAIASEIDIWFPVVDQLEV
PTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFSD
IVEGVDFDKDCEDPEYKPLQGPPKDQDDEGDPLMMMDEEISVIDGDEAQVTQQPGHLFWP
PGSALTARLRRLVTAYQRSYKREQMKIEAAERGDRRRRRCEAAFKLKEIARREKQQRWTR
REQTDFYRVVSTFGVEYDPDTMQFHWDRFRTFARLDKKTDESLTKYFHGFVAMCRQVCRL
PPAAGDEPPDPNLFIEPITEERASRTLYRIELLRRLREQVLCHPLLEDRLALCQPPGPEL
PKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFLAARMNYMQNHQAGAPAPSLSRC
STPLLHQQYTSRTASPLPLRPDAPVEKSPEETATQVPSLESLTLKLEHEVVARSRPTPQD
YEMRVSPSDTTPLVSRSVPPVKLEDEDDSDSELDLSKLSPSSSSSSSSSSSSSSTDESED
EKEEKLTDQSRSKLYDEESLLSLTMSQDGFPNEDGEQMTPELLLLQERQRASEWPKDRVL
INRIDLVCQAVLSGKWPSSRRSQEMVTGGILGPGNHLLDSPSLTPGEYGDSPVPTPRSSS
AASMAEEEASAVSTAAAQFTKLRRGMDEKEFTVQIKDEEGLKLTFQKHKLMANGVMGDGH
PLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMW
LQGHPEFAVDPRFLAYMEDRRKQKWQRCKKNNKAELNCLGMEPVQTANSRNGKKGHHTET
VFNRVLPGPIAPESSKKRARRMRPDLSKMMALMQGGSTGSLSLHNTFQHSSSGLQSVSSL
GHSSATSASLPFMPFVMGGAPSSPHVDSSTMLHHHHHHPHPHHHHHHHPGLRAPGYPSSP
VTTASGTTLRLPPLQPEEDDDEDEEDDDDLSQGYDSSERDFSLIDDPMMPANSDSSEDAD
D
NT seq 7746 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccccatcatggatctgttcgatgacccaaatttatttggcctggactctctg
actgatgacagctttaaccaggtcacacaagaccccattgaggaagcccttggactgcca
agctctctggactccttggatcagatgaaccaggatggtggaggtggtgatgtggggaat
tcatcagcaagtgaactggtccctccaccagaggaaacagctcccacagaactttccaaa
gaatccacagctccagctccagaatccataaccttgcatgattataccactcagcctgcc
agccaggagcagccagcccaacctgtcttacagacatcgacgccaacatcaggacttttg
caagtctccaagagccaggagatcctgagccaagggaatcctttcatgggtgtctctgcc
acagctgtctcctccagtagtgctggagggcagccacctcagtcagcccctaagattgtt
atccttaaggccccaccaagctcctcagtcactggtgcccatgtggcacaaattcaggcc
caaggtatcaccagcacagctcagcccctggtggcaggcacagccaatggtggaaaagtc
acttttaccaaagtgctaaccggcacaccccttcgaccaggtgtttccattgtctctggt
aatacagtgttggccgccaaggtccctgggaaccaggctgctgttcagcgcattgtccag
cccagccgaccagtaaagcagctggtcctccagccagttaagggttcagctcctgctgga
aaccctggggccacagggcccccactgaagcctgcagttacactgacctctacacctacc
cagggtgaatcgaaacgcatcaccctggtcctccagcagccacagtctggaggtccccaa
ggacatcggcatgttgtgctagggagtctaccaggcaagatagtgttacagggcaaccag
ctggcagccctgactcaagccaagaatgcccaagggcagcctgccaaggtagtaactatc
cagctgcaggtgcagcagccacagcaaaaaatccagattgtaccacaaccaccatcatcg
cagccacagccccagcagccaccctccacccagccagtgactctgtcctctgtacagcag
gctcagataatgggaccaggacaaagcccaggacaaagactttcagtaccagtcaaggtg
gtactgcagccacaggctggctcttcccaaggggcctcttctgggctctctgtagttaaa
gttctgagtgccagtgaagtggcagctttgtcatcaccagcaagctctgctcctcattcg
gggggaaagacaggaatggaggaaaaccgcagattggaacaccagaagaagcaagagaaa
gcaaatcggattgtagcagaggccattgcgagagcccgtgcccgcggtgagcagaacata
cctcgagtcttaaatgaggacgagttgcccagcgttcggccagaggaggaaggcgagaag
aaacgcaggaagaagagtgctggggagaggctgaaagaggagaagccaaagaagagtaaa
acatctggtgcctccaaaacaaagggcaagagcaagctcaacaccatcactcctgtagtg
ggtaagaagagaaaacgtaatacctcatctgataattcagatgtggaagtcatgcctgca
cagtcacctcgagaagatgaagaaagcagcattcagaagagacgctcaaaccgccaagtt
aagcgaaaaaaatatacagaggacctggatataaagatcacagatgatgaagaagaagaa
gaggtggatgtaactggtccaataaaacctgagcctatcctccctgaaccagtgcaagaa
ccagatggcgagactttgccttccatgcagttctttgtggagaatcccagtgaagaagat
gcagccattgtagacaaagtgctttctatgcggattgtgaagaaggagctcccttctgga
caatatactgaagcagaagaattctttgtcaagtacaagaactactcctatctgcattgt
gaatgggctactatctcccaactagagaaggataagaggatacatcaaaaattaaagcgc
ttcaaaaccaaaatggctcagatgagacacttcttccatgaggatgaagagccctttaat
ccagactacgtagaggtggataggatattggatgagtctcacagtattgacaaggacaat
ggggagcccgttatttactacctggtgaaatggtgctctctgccctatgaggatagcaca
tgggagctaaaagaagatgttgatgagggcaagattcgagaatttaaacggattcagtca
aggcacccagaactcaaaagggtgaatcgtccgcaggcaagtgcctggaagaaattggag
ctatcacatgaatataaaaacagaaaccagctacgggaatatcagttggaaggggttaat
tggctgctctttaattggtataacaggcagaactgcatcctggctgatgagatgggattg
ggcaaaactattcagtccattgccttcttgcaggaagtatataatgtgggcatccatggt
cccttcttggtcattgccccactgtccacaattactaactgggagcgagaatttaataca
tggacagaaatgaacactattgtgtaccatggcagtctggccagcaggcagatgattcaa
cagtatgaaatgtactgcaaagattcacggggacgcctcatcccaggcgcatacaagttt
gacgctctgatcaccacttttgagatgattttgtcagattgtcctgagcttcgtgaaatt
gaatggcgttgtgttatcattgatgaagcccatcgactgaaaaaccgtaattgcaagctg
cttgatagtctcaagcacatggacctggaacacaaggtgctactcacaggaacaccattg
caaaatactgtagaagaactgtttagcttgcttcatttcttggaaccgtcacaatttccc
tcagaatcagagtttctcaaggactttggggatctcaagacagaggaacaggttcaaaag
ctacaggccattcttaagccaatgatgctgagaagactcaaagaggatgttgaaaaaaac
ttggcacccaaacaggaaacaattattgaagtagagctgactaatatccagaagaaatac
tatcgggctattttggagaagaatttctccttcctttccaaaggggcaggtcataccaac
atgcctaatctacttaacacaatgatggagttgcgcaagtgctgcaaccacccatatctc
atcaatggtgctgaagaaaaaatcctaacagaattccgtgaagcttgccatattatacct
catgactttcacctgcaggccatggttcgttcagccggcaaactggttcttattgacaag
ttgcttccaaagcttaaagctggtggccataaagttctgatcttctctcagatggtgcgc
tgcctagacatcctagaggattatttaatccagaggaggtacttatatgaacgtattgat
gggcgagttagaggcaaccttcgacaggctgccattgaccgcttcagcaagcctgactca
gaccgctttgtcttcttactgtgtacccgggctggtggacttggtattaatcttacagct
gctgatacctgcatcatctttgattcagactggaatccacaaaatgacctgcaggcccag
gcacgatgtcatcgaattgggcagagcaaagctgtgaaggtgtaccgcctcatcactcgt
aattcctacgagagagagatgtttgataaggccagcctcaagttggggttggataaggct
gtgcttcaatccatgagtggtcgggatggcaacattactggaatccaacagttctctaag
aaggagattgaagatcttttaagaaaaggagcatatgcagccatcatggaggaagatgat
gaaggctccaagttttgtgaagaggacattgaccagatcttgttaagacgaactacaacc
atcaccattgaatctgaaggaaaaggttccacctttgctaaggcaagctttgttgcttct
gaaaacaggacagatatttctttggatgaccccaacttttggcaaaagtgggccaaaaag
gctgacctagacatggatctgctcaacagcaagaataatttggtaattgacacacctaga
gtacgaaaacaaacgcgccactttagcactctgaaagatgatgacctggtggaattctct
gatttggaaagtgaggatgatgagcggccacgctcccgcagacatgaccgtcatcatgcc
tatgggcgcactgactgctttcgggtggaaaagcatctcctggtatatggttggggacga
tggcgagatattttatctcatggacgcttcaagcgacgtatgactgaacgagatgtggag
accatttgtcgggccattctcgtgtactgtcttctacactaccgtggggatgaaaatatt
aaaggcttcatctgggacttgattagcccagctgaaaatggcaagacaaaagaattgcag
aatcattcaggtctatctatccctgtgcctcgtggacgcaaaggaaaaaaagtaaagtca
caaagcacttttgatatccataaggcagattggatccggaaatataaccctgacactttg
ttccaagatgaaagttataagaagcacttgaaacatcagtgtaacaaggtactgttgcgg
gtacgaatgctatactacctgaggcaggaggttattggagaccaagcagaaaaggtgtta
gggggtgcgattgccagtgagattgacatatggttcccagtagtggatcaactggaggtt
ccaacaacttggtgggacagtgaggctgacaagtcgctgctcattggagtctttaaacat
ggctatgagaaatataataccatgagggcagacccagccttatgtttcctagaaaaggct
ggccgaccagatgacaaagcaattgcagcagaacatcgagtgttggataacttctctgac
atagtagaaggggttgactttgataaagattgtgaagatcctgaatataaaccactccaa
ggtcccccaaaggaccaagatgatgagggtgatcccttgatgatgatggatgaggagatc
tcagtgattgatggagatgaagcccaggtgacccaacagccaggccatttattctggcct
ccgggctctgccctaacagctaggcttcggcgtctagtaacagcgtatcagcgcagctac
aagagagaacaaatgaagatagaggctgcagaacgtggggaccggcgaaggcggcgttgt
gaagcagccttcaagctgaaagaaattgcacggcgggagaaacaacaacgatggacaagg
cgtgaacaaactgatttttatcgagtggtgtctacgtttggtgtggaatatgaccctgac
accatgcagttccattgggatcgcttccgcacttttgctcgactagacaaaaagacagat
gaaagccttaccaagtacttccatggctttgtggccatgtgccgccaagtatgccgcctt
cccccagcagctggagatgaaccccccgaccctaacctgttcattgagcccatcactgag
gagagagcctcacggactctctaccgtatagaattgcttcggcgcttacgggaacaagtt
ttatgccacccccttttggaagatcggctggcattgtgtcagcctcctggtcctgaattg
cccaaatggtgggagcctgttcggcatgatggggagcttctaagaggggcagcccgccat
ggggtgagccaaacagactgcaacatcatgcaggacccagacttctcttttctggctgcc
cgtatgaattatatgcagaaccatcaagcaggagcaccagctccatccttgtcacgctgc
tctactccactgctgcaccagcagtatacctcacgcactgcctcaccactgcccctgcgc
ccagatgctcctgttgaaaagtcacccgaggagacagctacccaggtccccagtctggag
agtctgactttaaagctagagcacgaggtggtggccaggagccgaccaaccccacaagac
tatgagatgcgagtatccccctctgatactacccctctggtttcccggagtgttccacca
gtcaaactggaggatgaggatgattcggactctgagctggacttgagcaagctgtcacca
tcttcttcttcttcctcatcctcatccagctccagctccagcactgatgagagtgaggat
gagaaggaagagaagctaactgaccagtcccgctcaaagctctatgatgaagagagtctc
ctgtccctcactatgtcccaagatggattcccaaatgaagatggagaacaaatgacccct
gagcttctgctactgcaggaaagacaaagagcctctgagtggcccaaggatcgtgtcctg
ataaaccgtattgacctcgtctgccaggctgtactctcagggaagtggccttctagccgt
aggagccaggaaatggtaacaggaggaattttggggccaggcaaccacttgctagacagt
ccctcattgactcctggagaatatggtgactctccagtccccacaccacgaagtagtagt
gcagcttccatggcagaggaggaagcatctgcagtcagcacagcggcagcccagttcacc
aaacttcgccgaggcatggatgaaaaggagtttacagttcaaatcaaagatgaggaagga
ttgaagttaacattccagaagcacaagttgatggcgaatggagtaatgggagatggacat
ccactgtttcataagaagaaggggaacagaaagaagctagtagagctggaggtggagtgc
atggaagagcctaatcaccttgatgtggacctggagacccggatccctgtcatcaataag
gtggatggtactttgctggtgggtgaggatgcccctcgccgggctgaactggagatgtgg
ttacagggtcatccagagtttgctgttgatccccgatttctagcgtatatggaggatcgc
agaaaacagaagtggcaaagatgtaaaaaaaataataaggcagaattgaactgtttggga
atggaaccagtacagacagctaactctagaaatgggaaaaagggtcatcacactgaaacg
gtgttcaaccgggttttgccagggcctattgcaccagagagcagcaagaagcgggcccgt
aggatgcgaccagacctttctaagatgatggccctcatgcagggtggaagcactgggtct
ctatctctgcataacacgttccaacacagcagtagtggcctacagtctgtgtcatctttg
ggtcacagcagtgccacttctgcatctttgccttttatgccatttgtgatgggtggtgca
ccatcatcccctcatgtagactccagcaccatgcttcatcaccaccaccaccacccccac
ccccaccatcaccaccatcaccatccaggcttgagagcccctggctacccctcttcacca
gtgactaccgcctctggtactaccttgcggttgccaccactgcaacctgaggaggatgac
gatgaggatgaagaagatgatgatgacttatctcagggctatgatagctcagaaagggac
ttctcactcattgatgatcctatgatgccagctaactcagactccagtgaagatgctgat
gactga

DBGET integrated database retrieval system