KEGG   Homo sapiens (human): 577Help
Entry
577               CDS       T01001                                 

Gene name
ADGRB3, BAI3
Definition
(RefSeq) adhesion G protein-coupled receptor B3
  KO
K04598  
brain-specific angiogenesis inhibitor 3
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Brain-specific angiogenesis inhibitor (BAI)
    577 (ADGRB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q12
AA seq 1522 aa AA seqDB search
MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLE
NPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVF
LQYDKNFIQIRRVFPTNFPGLQKKGEEDQKSFFEFLVLNKVSPSQFGCHVLCTWLESCLK
SENGRTESCGIMYTKCTCPQHLGEWGIDDQSLILLNNVVLPLNEQTEGCLTQELQTTQVC
NLTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQW
STCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFT
CGRGQRTRTRSCTPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGT
QQRSRQCTAAAHGGSECRGPWAESRECYNPECTANGQWNQWGHWSGCSKSCDGGWERRIR
TCQGAVITGQQCEGTGEEVRRCSEQRCPAPYEICPEDYLMSMVWKRTPAGDLAFNQCPLN
ATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTK
TLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEK
WEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINF
PMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNY
TVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNESLGTWSTQGCK
TVLTDASHTKCLCDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALITLAVVYA
ALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVL
TEAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAKCG
VVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQG
FVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVL
HKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVISKVIIQQPTGLHMPM
SMNELSNPCLKKENSELRRTVYLCTDDNLRGADMDIVHPQERMMESDYIVMPRSSVNNQP
SMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLEQHLAPQEHMQNLPFEP
RTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQE
LNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKNPSEYPHYTTINVLDTEAKDALELRP
AEWEKCLNLPLDVQEGDFQTEV
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgttcgtaacctgctgatttatatattttccacctatctcctggttatgttt
ggatttaatgctgcccaagacttctggtgttcaactttggtgaagggagtcatttatgga
tcgtattctgtaagtgaaatgtttcctaaaaactttacaaactgcacttggacgctggaa
aatccagatccaaccaaatatagcatttacctgaaattttccaaaaaggaccttagctgc
tctaacttttcactcctggcttatcagtttgatcatttttcccatgaaaaaataaaggat
cttttaagaaagaatcattctataatgcaactctgcaattccaagaatgctttcgttttt
ctacagtatgataaaaattttattcaaatacgtcgagtatttccaactaatttcccagga
ttacagaaaaaaggggaagaagatcagaaatctttttttgagtttttggtattgaacaag
gtcagcccaagccagtttggttgccatgtattatgtacttggttggagagctgcttaaaa
tcagaaaatgggagaacagaatcatgtgggatcatgtatacaaaatgcacctgccctcag
catttgggagagtgggggatcgacgaccagtcgctgattttgttaaataacgtggtgtta
cccctgaatgagcagacagagggctgcctgacccaggagctgcaaaccacccaagtctgc
aatcttaccagggaggccaagcgaccacccaaagaagaatttggaatgatgggagatcat
acaattaaaagtcagcgacctcgatctgttcatgaaaaaagggtccctcaggaacaagct
gatgctgctaaatttatggcacaaactggtgaatctggtgtggaagagtggtcccagtgg
agcacatgttcggttacttgtggtcaagggtcgcaggtgcgaaccagaacttgtgtatca
ccttacgggacacactgcagcggcccattaagagaatcaagggtttgcaataacactgcc
ctctgtccagtacacggagtatgggaggaatggtcaccatggagtttatgttcatttaca
tgtggtcgaggccaaagaacaagaacaaggtcatgcacacctcctcagtatggaggaagg
ccgtgtgaaggacctgaaacacatcataagccttgtaatattgctctttgcccagttgat
ggacagtggcaagagtggagttcgtggagccagtgctcagtaacgtgctcgaatgggact
cagcagagaagccggcagtgcactgcagctgcccatggaggctccgaatgcagagggcca
tgggcagaaagcagagagtgctataaccctgaatgtacagccaatggtcaatggaatcag
tggggtcattggagtggttgttccaagtcctgtgatggcggctgggaaaggcgaataagg
acctgtcagggtgcagtgataacagggcagcaatgtgaaggaacgggcgaagaagtgaga
agatgcagtgagcagcgatgccctgcaccttatgaaatatgccctgaggattatctgatg
tcgatggtgtggaaaagaactccagcaggcgacttggcattcaatcaatgtcccctgaat
gccacaggcaccactagcagacgctgctctctcagtcttcatggagtggccttctgggaa
cagccgagctttgcaagatgcatatcaaatgagtacagacacttgcagcattcaattaaa
gagcaccttgctaaggggcagcgaatgctggcaggtgatggaatgtcccaggtgaccaag
acactgttggatttaactcagagaaaaaatttctatgcaggcgatcttctgatgtctgtg
gagatcctgagaaatgtgacagacacatttaaaagggcaagttacatccctgcatctgat
ggtgtccagaacttctttcaaatagttagcaaccttctagatgaagaaaacaaggaaaaa
tgggaagatgcacaacagatttatccagggtcaatagagttaatgcaggtgattgaagat
tttatacacattgttggaatggggatgatggactttcagaattcatacttaatgactgga
aatgtagtggctagtattcagaagcttcctgcagcctctgttctaacagacatcaacttt
ccaatgaaaggacggaagggaatggttgactgggcaagaaactcagaagatagggtagta
attccaaaaagcattttcactccggtgtcatcaaaagaattagatgaatcatctgtattt
gttcttggcgcagtcctatacaaaaacttagatctaattttgcccactttgagaaattat
actgtcattaattccaaaatcatcgtggtcacaataaggcctgaacccaaaacaaccgat
tcgtttctggagatagaactagctcatttggctaatggtactttgaatccctattgtgta
ttgtgggatgactccaaaacgaacgagtctttgggaacgtggtccacccagggatgtaaa
actgtgcttaccgatgcatcccatacgaaatgcttatgtgatcgtctctctaccttcgcc
attttggctcagcaacctagagaaataatcatggaatcctctggcacaccttcagttacc
ctaatagtaggcagtggtctttcttgcttggccttgattaccctagcagttgtctatgca
gcattatggaggtacatacgctctgagagatccataatactaattaacttctgcctgtct
atcatctcatccaatatcctcatactggttggacagactcagacacataataagagtatc
tgcacaaccaccactgcatttttgcactttttcttcctggcttcattctgttgggttttg
actgaggcgtggcaatcatatatggctgtaactggaaaaattaggacacggcttataaga
aaacgctttttgtgccttggatggggtttaccagcattagtagtggccacatcagtaggc
ttcaccagaacaaaaggatatggcactgatcactactgctggctctctcttgaaggagga
ctactctatgcttttgtgggacctgcagccgctgttgtcctggtcaacatggtgattggc
attttggtatttaataaacttgtttccagagatggaatcctagataaaaagctcaaacac
agagccggtcagatgagtgagcctcatagcggtttgacgctcaaatgtgccaagtgtgga
gtagtttcaacaacagctttgtcagccaccaccgccagtaacgccatggcgtctctttgg
agctcctgtgtggtgttgccccttctggctttgacgtggatgtctgcggttctggccatg
acagataaacgctccatattgtttcaaatactttttgctgtgtttgattcattgcaaggc
tttgttatagtcatggtccactgcattcttcggagagaggttcaggatgcatttagatgc
cgattgagaaactgtcaggatcccatcaatgcagattcttcgagttcgtttcctaatggg
catgctcaaatcatgacagactttgaaaaggatgtagacattgcctgtcgatcagttctt
cataaggatattggtccttgccgagcagccacaataacaggaacactttctaggatttct
ctaaatgatgatgaagaagaaaagggaacaaaccctgaagggctaagctattcaacattg
cctggaaatgtcatttccaaagtcatcatccagcaacccacaggtttgcacatgcccatg
agtatgaatgagcttagcaatccatgtttgaaaaaagaaaatagtgaattgcggagaact
gtgtacttatgtacggatgataatttgagaggggctgacatggacatagtccatcctcaa
gaaagaatgatggaaagtgactatattgtgatgcccagaagttctgtaaataaccagcct
tcaatgaaagaagaaagcaaaatgaatattggcatggaaaccttgccgcatgaaaggcta
ttgcactacaaagtaaaccctgaattcaatatgaatccccctgtaatggaccagttcaat
atgaacttagagcaacatctcgcaccccaggaacatatgcagaatttgccctttgaacct
cgcacagctgtgaagaatttcatggcctctgagttggatgataatgcaggactatcaaga
agtgaaactggatcaacgatatcaatgagttctttagagagaagaaaatcacgatattca
gaccttgactttgagaaggtcatgcatacaaggaagaggcatatggaactatttcaagaa
ctaaatcagaaatttcaaactttggacagatttcgggatataccaaatacaagcagtatg
gaaaaccccgcaccaaacaagaatccatgggacactttcaaaaaccccagtgaatacccg
cattacaccacaatcaatgtcttagacacagaggcaaaggatgctttggaactgaggcca
gcagagtgggagaagtgtctgaatttgcctctggatgtgcaagagggtgactttcaaaca
gaagtttaa

DBGET integrated database retrieval system