KEGG   Homo sapiens (human): 5770Help
Entry
5770              CDS       T01001                                 

Gene name
PTPN1, PTP1B
Definition
protein tyrosine phosphatase, non-receptor type 1 (EC:3.1.3.48)
Orthology
K05696  
tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Insulin signaling pathway
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    5770 (PTPN1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5770 (PTPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5770 (PTPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.1-q13.2
AA seq 362 aa AA seqDB search
MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEM
IFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLN
FLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEM
RKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPP
KRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSR
VVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNS
NT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcccaaaggagttacattcttacccagggccctttgcctaacacatgcggt
cacttttgggagatggtgtgggagcagaaaagcaggggtgtcgtcatgctcaacagagtg
atggagaaaggttcgttaaaatgcgcacaatactggccacaaaaagaagaaaaagagatg
atctttgaagacacaaatttgaaattaacattgatctctgaagatatcaagtcatattat
acagtgcgacagctagaattggaaaaccttacaacccaagaaactcgagagatcttacat
ttccactataccacatggcctgactttggagtccctgaatcaccagcctcattcttgaac
tttcttttcaaagtccgagagtcagggtcactcagcccggagcacgggcccgttgtggtg
cactgcagtgcaggcatcggcaggtctggaaccttctgtctggctgatacctgcctcttg
ctgatggacaagaggaaagacccttcttccgttgatatcaagaaagtgctgttagaaatg
aggaagtttcggatggggctgatccagacagccgaccagctgcgcttctcctacctggct
gtgatcgaaggtgccaaattcatcatgggggactcttccgtgcaggatcagtggaaggag
ctttcccacgaggacctggagcccccacccgagcatatccccccacctccccggccaccc
aaacgaatcctggagccacacaatgggaaatgcagggagttcttcccaaatcaccagtgg
gtgaaggaagagacccaggaggataaagactgccccatcaaggaagaaaaaggaagcccc
ttaaatgccgcaccctacggcatcgaaagcatgagtcaagacactgaagttagaagtcgg
gtcgtggggggaagtcttcgaggtgcccaggctgcctccccagccaaaggggagccgtca
ctgcccgagaaggacgaggaccatgcactgagttactggaagcccttcctggtcaacatg
tgcgtggctacggtcctcacggccggcgcttacctctgctacaggttcctgttcaacagc
aacacatag

DBGET integrated database retrieval system