KEGG   Homo sapiens (human): 5770Help
Entry
5770              CDS       T01001                                 

Gene name
PTPN1, PTP1B
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 1 (EC:3.1.3.48)
  KO
K05696  
tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Insulin signaling pathway
Insulin resistance
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    5770 (PTPN1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5770 (PTPN1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5770 (PTPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5770 (PTPN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5770 (PTPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.1-q13.2
AA seq 435 aa AA seqDB search
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaaaaggagttcgagcagatcgacaagtccgggagctgggcggccatttac
caggatatccgacatgaagccagtgacttcccatgtagagtggccaagcttcctaagaac
aaaaaccgaaataggtacagagacgtcagtccctttgaccatagtcggattaaactacat
caagaagataatgactatatcaacgctagtttgataaaaatggaagaagcccaaaggagt
tacattcttacccagggccctttgcctaacacatgcggtcacttttgggagatggtgtgg
gagcagaaaagcaggggtgtcgtcatgctcaacagagtgatggagaaaggttcgttaaaa
tgcgcacaatactggccacaaaaagaagaaaaagagatgatctttgaagacacaaatttg
aaattaacattgatctctgaagatatcaagtcatattatacagtgcgacagctagaattg
gaaaaccttacaacccaagaaactcgagagatcttacatttccactataccacatggcct
gactttggagtccctgaatcaccagcctcattcttgaactttcttttcaaagtccgagag
tcagggtcactcagcccggagcacgggcccgttgtggtgcactgcagtgcaggcatcggc
aggtctggaaccttctgtctggctgatacctgcctcttgctgatggacaagaggaaagac
ccttcttccgttgatatcaagaaagtgctgttagaaatgaggaagtttcggatggggctg
atccagacagccgaccagctgcgcttctcctacctggctgtgatcgaaggtgccaaattc
atcatgggggactcttccgtgcaggatcagtggaaggagctttcccacgaggacctggag
cccccacccgagcatatccccccacctccccggccacccaaacgaatcctggagccacac
aatgggaaatgcagggagttcttcccaaatcaccagtgggtgaaggaagagacccaggag
gataaagactgccccatcaaggaagaaaaaggaagccccttaaatgccgcaccctacggc
atcgaaagcatgagtcaagacactgaagttagaagtcgggtcgtggggggaagtcttcga
ggtgcccaggctgcctccccagccaaaggggagccgtcactgcccgagaaggacgaggac
catgcactgagttactggaagcccttcctggtcaacatgtgcgtggctacggtcctcacg
gccggcgcttacctctgctacaggttcctgttcaacagcaacacatag

DBGET integrated database retrieval system