KEGG   Homo sapiens (human): 57705Help
Entry
57705             CDS       T01001                                 

Gene name
WDFY4, C10orf64
Definition
(RefSeq) WDFY family member 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Pharos: 
Q6ZS81(Tdark)
UniProt: 
Position
10q11.23
AA seq 3184 aa AA seqDB search
MEAEDLSKAEDRNEDPGSKNEGQLAAVQPDVPHGGQSSSPTALWDMLERKFLEYQQLTHK
SPIERQKSLLSLLPLFLKAWEHSVGIICFPSLQRLAEDVSDQLAQQLQKALVGKPAEQAR
LAAGQLLWWKGDVDQDGYLLLKSVYVLTGTDSETLGRVAESGLPALLLQCLYLFFVFPLD
KDELLESDLQVQKMFVQMLLNICSDSQGLEGLLSGSELQSLLIATTCLREHSCCFWKEPT
FCVLRAISKAQNLSIIQYLQATDCVRLSLQNLSRLTDTLPAPEVSEAVSLILGFVKDSYP
VSSALFLEFENSEGYPLLLKVLLRYDGLTQSEVDPHLEELLGLVVWLTTCGRSELKVFDS
ITYPQLEGFKFHHEASGVTVKNLQAFQVLQNVFHKASDSVLCIQVLSVIRTMWAWNARNF
FLLEWTLQPISQFVEIMPLKPAPVQEHFFQLLEALVFELHYVPHEILRKVQHLIKESPGP
SCTLMALQSILSIAGGDPLFTDIFRDSGLLGLLLAQLRKQAKIMRKSGNKVSTPGVQDPE
RELTCVMLRIVVTLLKGSVRNAVVLKDHGMVPFIKIFLDDECYREASLSILEQLSAINAE
EYMSIIVGALCSSTQGELQLKLDLLKSLLRILVTPKGRAAFRVSSGFNGLLSLLSDLEGS
LQEPPLQAWGAVSPRQTLELVLYTLCAVSAALHWDPVNGYFFRRNGLFEKLAEDLCLLGC
FGALEEEGNLLRSWVDTKARPFADLLGTAFSSSGSLPPRIQSCLQILGFLDSMASGTLHL
RGDLKESLRTKQGPVVDVQKGETGSDPQRNFKQWPDLEERMDEGDAAIMHPGVVCIMVRL
LPRLYHEDHPQLSEEIQCSLASHIQSLVKSEKNRQVMCEAGLLGTLMASCHRALVTSGSP
LHSRLIRIFEKLASQAIEPDVLRQFLGLGIPSSLSATTKILDSSHTHRGNPGCSGSQTAQ
GLAEGPWPAAPDAGLHPGVTQAPQPLGESQDSTTALQTALSLISMTSPRNLQPQRAALAP
SFVEFDMSVEGYGCLFIPTLSTVMGTSTEYSVSGGIGTGATRPFPPPGGLTFSCWFLISR
HGAATEGHPLRFLTLVRHLARTEQPFVCFSVSLCPDDLSLVVSTEEKEFQPLDVMEPEDD
SEPSAGCQLQVRCGQLLACGQWHHLAVVVTKEMKRHCTVSTCLDGQVIGSAKMLYIQALP
GPFLSMDPSAFVDVYGYIATPRVWKQKSSLIWRLGPTYLFEEAISMETLEVINKLGPRYC
GNFQAVHVQGEDLDSEATPFVAEERVSFGLHIASSSITSVADIRNAYNEVDSRLIAKEMN
ISSRDNAMPVFLLRNCAGHLSGSLRTIGAVAVGQLGVRVFHSSPAASSLDFIGGPAILLG
LISLATDDHTMYAAVKVLHSVLTSNAMCDFLMQHICGYQIMAFLLRKKASLLNHRIFQLI
LSVAGTVELGFRSSAITNTGVFQHILCNFELWMNTADNLELSLFSHLLEILQSPREGPRN
AEAAHQAQLIPKLIFLFNEPSLIPSKISTIIGILACQLRGHFSTQDLLRIGLFVVYTLKP
SSVNERQICMDGALDPSLPAGSQTSGKTIWLRNQLLEMLLSVISSPQLHLSSESKEEMFL
KLGPDWFLLLLQGHLHASTTVLALKLLLYFLASPSLRTRFRDGLCAGSWVERSTEGVDIV
MDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDS
LDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEMLKATMSQPLAGSEDGAWAQTFPASVLQ
FLSLVHRTYPQDPAWRAPEFLQTLAIAAFPLGAQKGVGAESTRNTSSPEAAAEGDSTVEG
LQAPTKAHPARRKLREFTQLLLRELLLGASSPKQWLPLEVLLEASPDHATSQQKRDFQSE
VLLSAMELFHMTSGGDAAMFRDGKEPQPSAEAAAAPSLANISCFTQKLVEKLYSGMFSAD
PRHILLFILEHIMVVIETASSQRDTVLSTLYSSLNKVILYCLSKPQQSLSECLGLLSILG
FLQEHWDVVFATYNSNISFLLCLMHCLLLLNERSYPEGFGLEPKPRMSTYHQVFLSPNED
VKEKREDLPSLSDVQHNIQKTVQTLWQQLVAQRQQTLEDAFKIDLSVKPGEREVKIEEVT
PLWEETMLKAWQHYLASEKKSLASRSNVAHHSKVTLWSGSLSSAMKLMPGRQAKDPECKT
EDFVSCIENYRRRGQELYASLYKDHVQRRKCGNIKAANAWARIQEQLFGELGLWSQGEET
KPCSPWELDWREGPARMRKRIKRLSPLEALSSGRHKESQDKNDHISQTNAENQDELTLRE
AEGEPDEVGVDCTQLTFFPALHESLHSEDFLELCRERQVILQELLDKEKVTQKFSLVIVQ
GHLVSEGVLLFGHQHFYICENFTLSPTGDVYCTRHCLSNISDPFIFNLCSKDRSTDHYSC
QCHSYADMRELRQARFLLQDIALEIFFHNGYSKFLVFYNNDRSKAFKSFCSFQPSLKGKA
TSEDTLSLRRYPGSDRIMLQKWQKRDISNFEYLMYLNTAAGRTCNDYMQYPVFPWVLADY
TSETLNLANPKIFRDLSKPMGAQTKERKLKFIQRFKEVEKTEGDMTVQCHYYTHYSSAII
VASYLVRMPPFTQAFCALQGGSFDVADRMFHSVKSTWESASRENMSDVRELTPEFFYLPE
FLTNCNGVEFGCMQDGTVLGDVQLPPWADGDPRKFISLHRKALESDFVSANLHHWIDLIF
GYKQQGPAAVDAVNIFHPYFYGDRMDLSSITDPLIKSTILGFVSNFGQVPKQLFTKPHPA
RTAAGKPLPGKDVSTPVSLPGHPQPFFYSLQSLRPSQVTVKDMYLFSLGSESPKGAIGHI
VSTEKTILAVERNKVLLPPLWNRTFSWGFDDFSCCLGSYGSDKVLMTFENLAAWGRCLCA
VCPSPTTIVTSGTSTVVCVWELSMTKGRPRGLRLRQALYGHTQAVTCLAASVTFSLLVSG
SQDCTCILWDLDHLTHVTRLPAHREGISAITISDVSGTIVSCAGAHLSLWNVNGQPLASI
TTAWGPEGAITCCCLMEGPAWDTSQIIITGSQDGMVRVWKTEDVKMSVPGRPAGEEPPAQ
PPSPRGHKWEKNLALSRELDVSIALTGKPSKTSPAVTALAVSRNHTKLLVGDERGRIFCW
SADG
NT seq 9555 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagaagatctttcaaaggctgaagacagaaatgaagacccaggttccaaaaat
gaagggcagcttgctgctgtgcagcctgatgtcccacatggagggcagtcctccagcccc
acagctctctgggacatgctggaaaggaagtttctggaataccagcagttgactcacaag
agccccattgagcgtcagaagagcctgttgagtcttctccccctattcctaaaggcctgg
gaacactccgtggggatcatctgctttcccagtctccaaaggctggctgaagacgtgtct
gaccagcttgcccagcaactccagaaggcccttgtggggaagcctgcggagcaagctcgg
ttggcagctggacagttgctgtggtggaagggggacgtggatcaggatggctacttgctc
ctgaagtcagtgtacgtgctcacggggacagactcggagacgctgggcagggttgctgag
tctgggcttccagccctgctcctacagtgcctttacctcttctttgtctttcctctggac
aaagatgagcttcttgagagtgatcttcaagttcaaaagatgttcgtgcagatgttgctc
aatatttgcagtgactctcagggcctggagggactcctctcaggaagtgagctgcagtct
ctgctgattgccacgacctgccttcgggagcacagctgctgcttctggaaggaacccacc
ttctgcgtgctaagggcaatctccaaggcccagaacctcagcatcatccagtacctgcag
gccacagactgtgtcaggctctccctccagaacctctccaggctcacggacactctccct
gcccctgaagtgagcgaggctgtaagcctgatcttgggattcgtgaaggactcctacccc
gtctcctcggctctgttcctggagtttgagaattcagagggctatcctctgctgctcaaa
gtgttacttcggtatgatgggctgacccagagcgaagtggacccgcatctggaggagctc
cttgggctggtggtgtggctgacaacctgtgggaggtcagagctgaaggtgtttgacagc
atcacttaccctcagcttgaaggcttcaagttccatcatgaggcatctggggtgactgtt
aagaatcttcaggccttccaggtcctacagaatgttttccacaaagccagtgactctgtc
ctctgcatacaagtcttgtcagtcatcaggaccatgtgggcctggaatgctcgaaacttc
ttcctgctggagtggaccctgcagcccatctcgcagtttgtagagatcatgcccctgaag
ccggccccagtgcaggaacacttcttccagcttctagaggccctggtgttcgagctgcac
tacgtgcctcatgagatcctgcgaaaggtacagcatctgatcaaggagagccctgggcca
tcctgcaccctcatggccctgcagagcatcctcagcatcgctggtggggaccccctcttc
accgacatcttccgggactcagggctcctgggcctgctactggcacagcttcggaagcaa
gccaagatcatgaggaagtcaggaaacaaagtgtccactcctggtgttcaggatccagaa
agagaactcacctgtgtgatgctgaggattgtagtcacacttctgaaaggctcggtgagg
aatgcagttgtcctgaaggaccacggcatggtgcccttcatcaagatcttcctggatgac
gagtgctaccgggaggcctcgctcagcatcttggagcagctctcagccatcaacgccgag
gagtacatgagcatcattgtgggtgctctatgctcatccactcaaggggagctgcagctg
aaactggatctcctgaagtctctgctccggatcctggtgacccccaagggtcgtgctgcc
ttcagagtctccagcgggttcaacgggctgctgtctctgctctctgacctggaaggctcc
ctccaggagcccccgctgcaggcatggggagcagtatcccccagacagaccctggagctg
gttttgtacactctctgtgctgtgtccgcagcgctgcactgggaccctgtcaatggctac
ttcttcaggaggaatgggctctttgagaagctggccgaggacctctgcctgctgggctgt
tttggagccctggaggaagagggcaacctgctgcgctcttgggtggacacaaaggccagg
ccatttgcagatttgctgggcactgccttttcctccagcggctcactcccaccccggata
cagagctgcctccagatccttggctttctggacagcatggccagcggcaccctccacttg
cgtggggacctgaaggagtccctgaggaccaagcaggggccggttgtggatgttcagaag
ggagaaactggcagtgacccccaacgcaacttcaagcagtggccagacctggaggagagg
atggatgagggagatgctgcaatcatgcatcccggggtcgtgtgcatcatggtgaggctg
ctgcctcggttgtaccatgaagatcacccacagctttccgaggagatccagtgctccctg
gccagtcatatccagtccctggtgaagtcggagaagaaccgccaggtcatgtgcgaagca
ggcttgcttgggaccctcatggcctcctgccacagggccctggtcaccagtggcagcccc
ctccactcacgcctcatcaggatctttgagaagctcgcttcccaggccattgaaccggat
gtgctaagacagtttctaggtcttggaattccctcatctctgtcggccacaacaaaaatc
cttgattcatctcacacacacagaggcaaccctgggtgctcagggtcacagactgcacag
ggcttggctgaggggccctggccagctgccccagatgctgggctgcaccctggagtcaca
caggccccgcagcccttgggggaatcccaggattcaactactgctcttcagacggcgctg
agcctcatctccatgacctccccacgcaacctgcagcctcagagggcagccctggcccca
tcgtttgtggaatttgacatgtccgtggaaggttatggctgtttgtttattccaaccctg
tccacagttatgggaaccagcactgagtactctgtctctggaggaattgggacaggtgcc
accagaccgttccctcctcctggaggtctgaccttctcctgctggttcctgatcagccgg
catggagctgccactgagggccacccgctgcgcttcctgacgttggtgcgccacctggcc
aggactgagcaaccctttgtttgcttctccgtcagcctctgcccagacgacctctccttg
gttgtttctacagaagagaaggagtttcagcctctggatgtcatggaacctgaggatgac
tccgagccttctgcaggatgccagcttcaggtcaggtgtggccagctcctggcttgtggt
cagtggcatcacttggctgtggttgtcactaaggaaatgaaaaggcattgtacagtttcc
acctgtctggatggacaggtcattggctctgccaagatgttatacatccaggctctacca
gggcctttcctttctatggatccatccgcatttgtggatgtttatggatatattgctact
cctcgagtctggaaacaaaagtcttcattaatctggcgtcttggccccacatacctcttt
gaagaagccatttcaatggaaactctggaagttattaacaaacttggcccaagatattgt
ggtaacttccaagctgtgcatgtccaaggggaggacctggacagtgaagccacgcccttt
gttgcagaagaaagagtttcttttggacttcacatagccagctcctctatcaccagtgta
gcggacatcagaaatgcttacaatgaggtggacagccgcctgatcgccaaagagatgaac
atttcatcccgtgacaatgccatgcccgtgttcttgctgaggaattgtgctggccacctg
tcagggtctctgcggaccattggagctgttgctgtgggtcaattaggggtgagggtattc
cactccagccctgctgccagcagcctggacttcattggcgggcctgccatcctcctgggc
ctcatctccttagcgacagatgaccataccatgtatgcggctgtgaaagttctgcactcg
gtcctgaccagtaatgccatgtgtgacttcctgatgcaacacatctgtgggtaccagata
atggcgtttctcctgaggaagaaggcctctctcctgaaccatcgaatttttcagctgatc
ctctcagtggctggcactgtggagctgggcttcaggtcatctgctatcaccaacactggt
gtcttccagcacatcctctgcaatttcgagctctggatgaatactgcagacaatctggag
ctcagcctcttttcccatcttttggaaatccttcaatcaccaagggaaggacccaggaat
gctgaagctgcccaccaggcacagcttatacccaagctcatcttcctattcaatgagccg
agcctcatcccctccaagatctccaccatcattggcatcctggcctgtcagctgaggggc
cacttcagcacccaggacttgctcaggattgggctgtttgttgtgtacaccctcaagcct
tcgtcggtgaatgagaggcagatctgcatggacggagccctggacccttccctgcctgct
ggaagccaaacatctggaaagacaatctggctcagaaaccagttgctggagatgctgctc
agtgtaatatcttccccccagcttcatctgtcctctgagtcaaaggaagagatgtttctg
aaactggggcctgactggttcctgctgctcctgcagggccacctgcatgccagcaccact
gtgctggcattgaagctgctgctgtactttctggcaagcccctccctccgcacacggttt
agagatggcctgtgtgcaggatcctgggtggaacgcagcactgagggcgtggatattgta
atggacaacctgaagagccagtcaccactgcctgagcaaagcccatgcctgcttcctggg
ttccgtgtcttgaatgactttctggcccaccacgtccacattccagaggtctacctcatc
gtctccaccttcttcctgcagacaccactcacagagctgatggacgggcccaaagacagc
cttgatgccatgcttcagtggctcctgcagaggcaccaccaggaagaagtcctccaggct
gggctgtgcacagaaggtgccttgctcctcctggaaatgctgaaggccaccatgagccag
cccctggcaggttctgaggatggtgcctgggcacagaccttcccggccagcgtgctgcag
ttcctcagcctcgtccaccgcacctacccccaggacccagcgtggcgagccccggagttc
ctccagaccttggccatagccgccttccccctgggagcccaaaagggggttggggctgag
tccacccggaacaccagcagtcctgaggccgcagctgaaggcgacagcacagtggagggt
ctccaggctcccaccaaggcacatcccgcccggaggaagctgagggagttcacgcagctc
ctcttgagggagctcctgcttggagcctccagccccaagcagtggctgcccctggaggtg
ctcctggaggcttctccagaccacgccaccagccaacagaagcgagacttccagtccgag
gtcctgctttctgctatggaactattccacatgacaagtggaggtgatgcagcgatgttc
agagacggcaaagagcctcagccaagtgcagaagctgctgctgccccttctcttgccaac
atctcctgcttcacccagaagctggtggagaagctgtacagtgggatgttctcggcagac
cccaggcatatcctcctcttcatcctggagcacatcatggtggtcattgagactgcctct
tctcaaagggacactgtcctcagcactttatacagcagtttaaataaagtcattctttat
tgcctatccaagccccagcagtccctctccgaatgcctcggccttctcagcatcctgggc
tttctgcaggagcactgggatgttgtctttgccacctacaattccaacatcagcttcctc
ctgtgtctcatgcattgccttttgctactcaatgagagaagttacccagaaggatttgga
ttggagcccaagcctagaatgtctacttatcatcaagtcttcctttccccaaatgaagac
gtgaaagaaaaaagagaagacttaccaagtttgagtgatgtccaacacaacatccagaag
acagtgcagactctctggcagcagctggtggcacaaaggcagcagaccctggaggatgcc
ttcaagatcgatctctctgtgaaacctggagagagggaagtgaagattgaagaggtcaca
ccgctctgggaggagacgatgctcaaggcctggcagcattacttagcatctgagaagaag
tcactggcaagtcgttcaaatgttgcacaccacagcaaagtcactttgtggagtggaagc
ctgtcctcagccatgaagctgatgcccgggcggcaggccaaggaccctgagtgcaagaca
gaggattttgtgtcatgtatagagaactacagaagaagaggacaagagctatatgcatct
ttatacaaagaccatgtgcaaaggcgaaaatgtggcaacatcaaggcagccaacgcctgg
gccaggatccaggagcagctttttggggagctgggcttgtggagccagggggaagaaacc
aagccctgttccccatgggaactcgactggagagaaggaccagctcgaatgaggaaacgc
atcaaacgcttgtctcctttggaggccctgagctcaggaaggcacaaggaaagccaagac
aaaaatgatcatatttctcaaacaaatgctgaaaaccaagatgaactgacactgagggag
gctgagggcgagccggacgaggtgggggtggactgcacccagctgaccttcttcccagcc
ttacacgaaagtctgcactcagaagacttcttggaactgtgtcgggaaagacaagttatt
ttacaagagcttcttgataaagaaaaggtgacgcagaagttctccctggtgattgtgcag
ggccacctggtgtcagaaggggtcctgctttttggccaccaacacttctacatctgcgag
aacttcacactgtctcccacgggtgatgtctactgtacccgtcactgcttatccaacatc
agcgatccgttcattttcaacctgtgcagcaaagacaggtccactgaccattactcgtgc
cagtgccacagctacgctgacatgcgggagctacggcaggctcgcttcctcctgcaggac
atcgccctggagatcttcttccacaatggatattccaagtttcttgtcttctacaacaat
gatcggagtaaggcctttaaaagcttctgctctttccaacccagcctgaaggggaaagcc
acctcggaggacaccctcagtctaaggagataccccggctctgacaggatcatgctgcag
aagtggcagaaaagggacatcagcaattttgagtatctcatgtacctcaacaccgcggct
gggagaacctgcaatgactacatgcagtacccagtgttcccctgggtcctcgcagactac
acctcagagacattgaacttggcaaatccgaagattttccgggatctttcaaagcccatg
ggggctcagaccaaggaaaggaagctgaaatttatccagaggtttaaagaagttgagaaa
actgaaggagacatgactgtccagtgccactactacacccactactcctcggccatcatc
gtggcctcctacctggtccggatgccacccttcacccaggccttctgcgctctgcagggc
ggaagcttcgacgtggcagacagaatgttccacagtgtgaagagcacgtgggagtcggcc
tccagagagaacatgagtgacgtcagggagctgaccccagagttcttctacctgcctgag
ttcttaaccaactgcaacggggtagagttcggctgcatgcaggacgggactgtgctagga
gacgtgcagctccctccctgggctgatggggaccctcggaaattcatcagcctgcacaga
aaggccctggaaagtgactttgtcagtgccaacctccaccattggatagaccttattttt
gggtacaagcagcaggggccagccgcagtggatgctgttaatatcttccacccctacttc
tacggtgacagaatggacctcagcagcatcactgaccccctcatcaaaagcaccatcctg
gggtttgtcagcaactttggacaggtgcccaaacagctctttaccaaacctcacccagcc
aggactgcagcagggaagcctctgcctggaaaggatgtctccacccccgtgagcctgcct
ggccacccacagccctttttctacagcctgcagtcgctgaggccctcccaggtcacggtc
aaagatatgtacctcttttctctaggctcagagtcccccaaaggggccattggccacatt
gtctctactgagaagaccattctggctgtagagaggaacaaagtgctgctgcctcctctc
tggaacaggaccttcagctggggctttgatgacttcagctgctgcttggggagctacggc
tccgacaaggtcctgatgacattcgagaacctggctgcctggggccgctgtctgtgcgcc
gtgtgcccatccccaacaacgattgtcacctctgggaccagcactgtggtgtgtgtgtgg
gagctcagcatgaccaaaggccgcccgaggggcttgcgcctccggcaggccttgtatgga
cacacacaggctgtcacgtgcctggcagcgtcagtcaccttcagcctcctggtgagcggc
tcccaggactgcacctgtatcctgtgggatctggaccacctcacccacgtgacccgcctg
cccgcccatcgggaaggcatctcagccatcaccatcagtgacgtctcaggcaccattgtc
tcctgtgcgggagcacacttgtccctgtggaatgtcaatggacagcccctggccagcatc
accacagcctggggcccagaaggagccataacctgctgctgcctgatggagggcccagca
tgggacacaagccagatcatcatcaccgggagtcaagacggcatggtccgggtttggaag
actgaggatgtgaagatgtctgttcctggacggccagcaggagaggagcccccggctcag
cctccaagcccaagaggccacaagtgggagaagaacctggccttgagtcgagagctggac
gttagcattgctttgacagggaagcccagcaaaaccagccccgcagtgactgctctggcc
gtgtccagaaaccacaccaaactcctggttggtgatgagagggggagaatattctgctgg
tctgcagatgggtag

DBGET integrated database retrieval system