KEGG   Homo sapiens (human): 5771Help
Entry
5771              CDS       T01001                                 

Gene name
PTPN2, PTN2, PTPT, TC-PTP, TCELLPTP, TCPTP
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 2 (EC:3.1.3.48)
  KO
K18026  
tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Disease
H00408  
Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5771 (PTPN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5771 (PTPN2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5771 (PTPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.3-p11.2
AA seq 415 aa AA seqDB search
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaccatcgagcgggagttcgaagagttggatactcagcgtcgctggcagccg
ctgtacttggaaattcgaaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaaatgctgagaatgattatattaatgccagtttagttgacatagaagaggcacaa
aggagttacatcttaacacagggtccacttcctaacacatgctgccatttctggcttatg
gtttggcagcagaagaccaaagcagttgtcatgctgaaccgcattgtggagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccaagagatgctgtttaaagaaacagga
ttcagtgtgaagctcttgtcagaagatgtgaagtcgtattatacagtacatctactacaa
ttagaaaatatcaatagtggtgaaaccagaacaatatctcactttcattatactacctgg
ccagattttggagtccctgaatcaccagcttcatttctcaatttcttgtttaaagtgaga
gaatctggctccttgaaccctgaccatgggcctgcggtgatccactgtagtgcaggcatt
gggcgctctggcaccttctctctggtagacacttgtcttgttttgatggaaaaaggagat
gatattaacataaaacaagtgttactgaacatgagaaaataccgaatgggtcttattcag
accccagatcaactgagattctcatacatggctataatagaaggagcaaaatgtataaag
ggagattctagtatacagaaacgatggaaagaactttctaaggaagacttatctcctgcc
tttgatcattcaccaaacaaaataatgactgaaaaatacaatgggaacagaataggtcta
gaagaagaaaaactgacaggtgaccgatgtacaggactttcctctaaaatgcaagataca
atggaggagaacagtgagagtgctctacggaaacgtattcgagaggacagaaaggccacc
acagctcagaaggtgcagcagatgaaacagaggctaaatgagaatgaacgaaaaagaaaa
aggtggttatattggcaacctattctcactaagatggggtttatgtcagtcattttggtt
ggcgcttttgttggctggacactgttttttcagcaaaatgccctataa

DBGET integrated database retrieval system