KEGG   Homo sapiens (human): 57731Help
Entry
57731             CDS       T01001                                 

Gene name
SPTBN4, QV, SPNB4, SPTBN3
Definition
spectrin, beta, non-erythrocytic 4
Orthology
K06115  
spectrin beta
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.13
AA seq 2564 aa AA seqDB search
MAQVPGEVDNMEGLPAPNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADERE
AVQKKTFTKWVNSHLARVGCHIGDLYVDLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHSL
ENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETR
SAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANYN
LQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKV
LDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKP
VKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAE
LIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIAA
YEERVQGVAELAQALAAEGYYDIRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKV
FQEMVYMVDWMEEMQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALR
FSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESWA
RDKERLLEAAGGGGAAGAAGAAGTAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALR
CGEELVAAGGAVGPGADTVHLVGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGA
DLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVSGLRRQLATLG
GASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEK
EQWLLSMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVRS
CQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGAL
QWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAARLHQGAEELGAEWGALASAAQAC
GEAVAAAGRLQRFLHDLDAFLDWLVRAQEAAGGSEGPLPNSLEEADALLARHAALKEEVD
QREEDYARIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEARREALVQAHI
YQLFLRDLRQALVVLRNQEMALSGAELPGTVESVEEALKQHRDFLTTMELSQQKMQVAVQ
AAEGLLRQGNIYGEQAQEAVTRLLEKNQENQLRAQQWMQKLHDQLELQHFLRDCHELDGW
IHEKMLMARDGTREDNHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAAS
VRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPGG
DLATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRL
LEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGNGLQAVQQHIKKNQGL
RREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERRQQVLDAA
FQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQL
SRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVALEQQYWLYQLSRQVSELE
HWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGMAGRERLAAVNQMVDELIECGHT
AAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRL
TTPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEV
LQGWKELLSACEDARLHVSSTADALRFHSQVRDLLSWMDGIASQIGAADKPRDVSSVEVL
MNYHQGLKTELEARVPELTTCQELGRSLLLNKSAMADEIQAQLDKLGTRKEEVSEKWDRH
WEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAW
EERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPL
ARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPAALPAAPEDAAETPAT
PAAAEQVRPRPERQESADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHEAAHS
LTLGRYEQMERRRERRERRLERQESSEQEMPIRGDLVKGKATLADIVEQLQEKEAGPGLP
AGPSLPQPRELPPGRLPNGLELPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRS
APAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDS
KGPASGSTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLE
AVASSVAEHAEIARWGQTLPTTSSTDEGNPKREGGDRRASGRRK
NT seq 7695 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggtaccaggggaagtggacaacatggagggcctgcctgctcctaacaacaac
cctgctgcccgctgggagagtccggatcggggctgggagcgggagcagccggctgcgtcc
accgcagcggcctcgctctttgagtgctcccggatcaaggccttggcagatgagcgggaa
gccgtgcagaagaaaaccttcaccaagtgggtgaactcgcacctcgcccgcgtgggctgc
cacatcggggacctctatgtggacctccgggacggcttcgtgctcacgcggctcctggaa
gtgctgtctggggagcagctgcccaggcccacgcgcggccgcatgcggatccactcactg
gagaacgtggacaaggcgctgcagtttctgaaggagcagcgcgtgcacctggagaacgtg
ggttcgcatgacatcgtggatgggaatcaccggctgacgctggggctggtctggaccatc
atcctgcgcttccagattcaagtcatcaaaattgagactgaggacaacagagagacacgc
tcagccaaggatgctctgctcttgtggtgtcagatgaagacagctggttaccctgaggta
aacatccagaatttcaccaccagctggcgggatggcttggccttcaatgccctcattcac
cggcacaggcctgatctcgtggacttcagcaaactcaccaagtccaatgccaactacaac
ctgcagagagccttccgcacagctgagcagcacctggggctggcgcggctgctggatcct
gaagatgtgaacatggaggctccagatgagaagtccatcatcacctacgtggtctctttc
taccactatttctccaagatgaaggctctggctgtggaggggaagcgtatcgggaaggtc
ttggaccaggtattggaggtggggaagatcatagaacgctacgaggagctggcggctgag
ctgctggcctggatccaccgcaccgtgggcctcatcagcaatcagaaatttgccaactcc
ttaagtggggtgcagcagcaactccaggctttcacggcctattgcacgctggagaagcct
gtcaagttccaggagaaggggaacctagaggtgctgctcttcagcatccagagcaaactg
cgtgcctgcaaccgtcgcctctttgtgcctcgggagggctgtggcatctgggatattgac
aaggcatggggtgagctggagaaggctgagcatgagcgggaggctgccctacgggctgag
ctgattcggcaggagaagctggaactactggcacagaggtttgaccacaaggtggctatg
agggagagctggctgaatgagaaccagcgtctggtctcccaggacaactttgggtatgag
ctgcccgcagtggaggcagccatgaagaaacacgaagcgatcgaggcagacattgcggcc
tacgaggagcgggtgcagggtgtggcggagctggcccaggcattggcagccgaaggctac
tacgatatccggcgggtggcagcccagcgtgacagcgtcctgcgccagtgggccctgcta
actgggcttgtgggtgcccggcggacacgacttgagcagaaccttgccctgcagaaggtc
ttccaggagatggtgtacatggtggactggatggaggagatgcaggctcagctgctgtcc
cgggagtgtgggcagcacctggtggaggcagacgacctgttgcagaagcatggactgctg
gagggagacattgccgcccagagcgagcgggtggaggctctcaatgccgctgccctgcgc
ttctcccagctgcagggctaccagccctgcgacccgcaggtcatctgcaaccgcgtgaac
cacgtgcacggctgcctggcggagctgcaggagcaggcagcgcggcgacgcgcggagctg
gaggcttcgcggagcctgtgggcgctgctgcaggagctggaggaggccgagagctgggcg
cgcgacaaggagcgtctcctggaggctgcgggcggcggcggtgcggcgggcgcagcgggc
gcagcgggaacagcgggcggcgcgcatgacctgtccagcacagcgcgcctcctggcccag
cacaagatcctgcagggcgagctgggcgggcggcgagcgttgctgcagcaggccctgcgg
tgtggcgaggagctggttgcggccggcggtgccgtcggcccgggagcagacaccgtgcac
ctggtaggcctggcggagcgcgcggcgagcgcccggcgccgctggcagaggctggaagag
gcggcggcgcggcgagagcggcggctgcaggaggcgcgggcgctgcaccagttcggcgct
gacctcgacgggctgctggactggcttcgcgacgcttaccgcctggcagccgccggtgac
ttcggccacgacgaagcttccagccgccgcctggcgcgccagcaccgcgcgctcaccggg
gaggtggaggcacatcgcgggcccgtgagcggcctgcggcgccagctggcgacactcggg
ggtgccagtggcgcagggccactggtggtggcgctgcaggtgcgcgtggtggaagcagag
cagttgttcgctgaggtgaccgaagtggcggcgctgaggcgccagtggctgcgggacgcg
ctcgctgtctaccgcatgtttggcgaggtgcacgcgtgtgagctgtggatcggcgagaag
gagcaatggctgctctccatgcgtgtgccggattcactcgacgacgtcgaggtggtgcag
caccgattcgagagcctggaccaagagatgaacagcctgatgggccgcgttctggacgtg
aaccacacagtccaggagctggtggaaggaggccaccccagttcagatgaggtgcgttcc
tgccaggaccacctcaacagcaggtggaaccgcatcgtggagctagtggaacagcgcaaa
gaggaaatgagcgcggtgctgctggtggagaaccacgtgctggaggtggccgaggtgcgc
gcccaggtgcgtgagaagcggagagctgtggagagcgcgccccgggccggcggcgccctg
cagtggcgtcttagcggcctagaggccgctctgcaggcgctggagccgcgccaggcggcc
cttctggaggaggcagccctgctggctgagcgcttcccggcgcaggcggcgcggctgcac
cagggcgcggaggagctgggcgccgagtggggcgcgctagctagcgcggctcaggcctgc
ggcgaggcggtggcggcagcagggcgcctgcagcgcttcctacatgacctcgacgctttc
ctggactggctcgtgcgcgcccaggaggcggcgggcggcagcgaggggcccctgcccaac
agcctagaagaggcggacgcgctgctggcgcgccacgctgcgctcaaggaggaggtggac
cagcgcgaggaagactatgctcgcatcgtggcggccagcgaggcgctgctggccgccgac
ggcgcagagctgggcccgggcctggcactagacgagtggctgccacacctcgaacttggc
tggcataaactgctcggcttgtgggaggcgcgcagggaggcgctggtccaggcgcacatc
taccagctcttcctgcgggatctacgccaggcgctcgtggtgctgcgtaaccaggagatg
gcgctgtctggtgcggagctcccgggcacagtggaatcggtggaggaggccttgaaacag
caccgtgactttctcaccaccatggagctgagccagcaaaagatgcaggtggccgtgcag
gctgcagagggcctgctgaggcagggcaacatctacggggagcaggctcaggaggctgtg
acccggctgctggagaagaaccaagaaaaccagttacgggcccagcaatggatgcaaaag
ctacatgaccaacttgagctgcagcacttcctccgagactgccacgagctggatggctgg
atccatgagaagatgctgatggcgcgggatggcacgcgggaggacaaccacaagctgcat
aagagatggctccggcaccaggcattcatggccgagctggctcagaataaggagtggctg
gagaagatcgagcgggagggccagcaactgatgcaggagaagcccgaactggcggcctcc
gtgcggaagaagctgggcgagatccgccagtgctgggcggagctggagagcaccacccag
gccaaggcacggcagctctttgaggccagcaaagcagaccagctggtgcagagctttgct
gagctggacaagaagctccttcacatggagagccagctgcaagacgtggaccctggagga
gacctggccactgtcaacagtcagctcaagaagctgcagtccatggagtcgcaggtggag
gagtggtaccgcgaggtgggagagctgcaggcgcagacggcggcgctgccgctggagccg
gcgagcaaggagctggtgggtgagcggcagaacgcggtgggcgagcgcctggtgcgcctg
ctcgagccgttgcaggagcgccgccgcttgctgctggcttccaaggagttgcaccaggtg
gcgcacgacctggacgacgagctggcatgggttcaggagcggctgccactggccatgcag
acagagcgaggcaacggtttgcaggcggtccagcagcacatcaaaaagaaccagggcctg
cggcgggagatccaggcgcatgggccgcgcctggaggaggtgctggagcgcgcgggcgcg
ctggcgtcgctgcgcagcccggaggcagaggcagtgcgccggggcctggagcagctgcag
agcgcctgggccggactgcgggaggctgccgagcgacggcagcaggtgctggacgccgcc
ttccaggtggagcagtactacttcgacgtggctgaggtggaggcgtggctgggcgagcag
gagctgctcatgatgagtgaggacaagggcaaggacgaacagagcaccctgcagctgctc
aagaaacacctgcagctggagcaaggcgtggagaactacgaggaaagcatcgcgcagctg
tcgcgccagtgccgggcgctgctggagatggggcacccggacagcgagcagatcagccgg
cggcagtctcaggtggaccgcctgtacgtggcgctcaaggagctgggtgaggagcgccgg
gtggctctggaacagcagtactggctgtaccagctcagccgccaggtgagcgagcttgag
cactggattgccgagaaggaggtggtggctggctcacccgagctcggccaggactttgag
catgtctcggtgctgcaggagaaattctcagagtttgccagcgagacaggtatggcaggg
cgggaacggctggcagctgtgaaccagatggtggatgagctgatcgagtgtggccataca
gcagcggccaccatggccgagtggaaggacggactgaacgaggcctgggctgagctgctg
gagctcatgggcacacgggcccagctgctggccgcctctcgggagcttcataagttcttc
agtgacgcccgagagcttcagggacagattgaggagaagcggaggcggctgccccgcctg
accaccccgcctgagccgagacccagtgccagttccatgcagcggaccctgagagccttt
gagcatgacctgcagctcctcgtgtcccaggtacggcagctgcaggagggggcggcccag
ctgcggacggtgtatgcgggtgaacatgccgaggccatcgctagccgggagcaggaggtg
ctgcagggttggaaagagctgctgtcagcctgtgaggatgcccgcctgcatgtcagctcc
acagccgacgccctgcgcttccacagccaagtccgcgacctgctctcctggatggatggc
atcgccagccagattggggcagccgacaagcccagggacgtgtcatcagtggaggtgctc
atgaactaccaccagggcctgaagactgagctggaggcgcgggtgcctgagctgaccacc
tgccaggagctggggcgatctctgctgctcaacaaaagtgccatggctgatgagatccag
gcacagctggacaagctgggaaccaggaaggaggaggtgtcggaaaagtgggaccgccat
tgggagtggctgcagcagatgctggaggtgcaccagtttgcccaggaggcggtggtggct
gatgcctggctgacagcccaggagccgctcctgcagagccgggagctgggcagcagcgtg
gatgaggtggagcagcttatccggcgacatgaggccttccgcaaagcggctgcagcctgg
gaagagaggttcagctctctgcggcgcctgaccacgatcgagaaaatcaaagcggaacag
agcaagcagccgcctaccccactgctggggcgcaagttctttggggaccccacggaactg
gcggccaaggcggcgcccctgctgcggccagggggctatgaaaggggcttggagcccctg
gcccgccgagcctcggacacgctctcggccgaggtgcggactcgggtggggtatgtgcgc
caggagctcaagcccgagcgcctccagccgcgcattgaccggctgccggagatcccgggg
agggtggagcccgcggccctgccggccgcaccagaggacgcggcggagacccccgcgacc
cccgcggcggcggagcaggtgcggccacgaccggagcgccaggagtcagctgatcgcgcg
gaggagctgcccaggaggcggcggcctgagcggcaagagtcagtcgatcaatccgaggag
gctgcgcggaggcggcggccggagcggcaggagtcagcggagcacgaggcggcacacagc
cttaccctgggccgctatgagcagatggagcggcggcgcgagcggcgtgagcggcgcttg
gagcggcaggagtccagcgaacaggagatgcccatcagaggagacctggtcaaggggaag
gccaccctggctgacattgtggaacagctgcaggagaaagaggcaggcccagggctgcct
gctgggccgtcgctgcctcagccacgcgagcttcccccaggtcgcctgcccaacgggctt
gagctgcccgagcggacacctcggccggaccggccccgggcgcgggaccggcccaagccg
cgacggcggccgcggcccagagagggtggtgagggcgggggaagccggcgctcgcgctcc
gccccggcccagggcggctccgcccccgcgcctccgccaccgcccactcacacagtgcag
cacgagggcttcctactgcgcaagcgcgagctcgacgctaaccgcaagtcgtccaaccgg
tcgtgggtgagcctgtactgtgtgcttagtaagggggaactgggcttctacaaggactcc
aagggcccggcatccgggagcacacacggtggggaaccgctgctcagcctgcacaaggcc
accagcgaggtggctagtgactacaagaaaaagaagcatgtcttcaagctccagacccag
gatggcagtgagtttttgctccaggcaaaagatgaggaggagatgaacggctggctggag
gctgtagcttcctcggtggcggaacacgcagagatcgcccgctggggccagacactaccc
actacttcatccacagatgagggcaaccctaagagggaaggcggagatcgcagggccagc
gggcgcaggaagtga

DBGET integrated database retrieval system