KEGG   Homo sapiens (human): 5777Help
Entry
5777              CDS       T01001                                 

Gene name
PTPN6, HCP, HCPH, HPTP1C, PTP-1C, SH-PTP1, SHP-1, SHP-1L, SHP1
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 6
  KO
K05697  tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa05140  Leishmaniasis
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5777 (PTPN6)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    5777 (PTPN6)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5777 (PTPN6)
   04660 T cell receptor signaling pathway
    5777 (PTPN6)
   04662 B cell receptor signaling pathway
    5777 (PTPN6)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5777 (PTPN6)
  Infectious diseases
   05140 Leishmaniasis
    5777 (PTPN6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5777 (PTPN6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5777 (PTPN6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 5777
NCBI-ProteinID: NP_002822
OMIM: 176883
HGNC: 9658
Ensembl: ENSG00000111679
Vega: OTTHUMG00000168518
Pharos: P29350(Tchem)
UniProt: P29350
Structure
PDB: 

Jmol
Position
12p13.31
AA seq 595 aa AA seqDB search
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggtggtttcaccgagacctcagtgggctggatgcagagaccctgctcaagggc
cgaggtgtccacggtagcttcctggctcggcccagtcgcaagaaccagggtgacttctcg
ctctccgtcagggtgggggatcaggtgacccatattcggatccagaactcaggggatttc
tatgacctgtatggaggggagaagtttgcgactctgacagagctggtggagtactacact
cagcagcagggtgtcctgcaggaccgcgacggcaccatcatccacctcaagtacccgctg
aactgctccgatcccactagtgagaggtggtaccatggccacatgtctggcgggcaggca
gagacgctgctgcaggccaagggcgagccctggacgtttcttgtgcgtgagagcctcagc
cagcctggagacttcgtgctttctgtgctcagtgaccagcccaaggctggcccaggctcc
ccgctcagggtcacccacatcaaggtcatgtgcgagggtggacgctacacagtgggtggt
ttggagaccttcgacagcctcacggacctggtggagcatttcaagaagacggggattgag
gaggcctcaggcgcctttgtctacctgcggcagccgtactatgccacgagggtgaatgcg
gctgacattgagaaccgagtgttggaactgaacaagaagcaggagtccgaggatacagcc
aaggctggcttctgggaggagtttgagagtttgcagaagcaggaggtgaagaacttgcac
cagcgtctggaagggcagcggccagagaacaagggcaagaaccgctacaagaacattctc
ccctttgaccacagccgagtgatcctgcagggacgggacagtaacatccccgggtccgac
tacatcaatgccaactacatcaagaaccagctgctaggccctgatgagaacgctaagacc
tacatcgccagccagggctgtctggaggccacggtcaatgacttctggcagatggcgtgg
caggagaacagccgtgtcatcgtcatgaccacccgagaggtggagaaaggccggaacaaa
tgcgtcccatactggcccgaggtgggcatgcagcgtgcttatgggccctactctgtgacc
aactgcggggagcatgacacaaccgaatacaaactccgtaccttacaggtctccccgctg
gacaatggagacctgattcgggagatctggcattaccagtacctgagctggcccgaccat
ggggtccccagtgagcctgggggtgtcctcagcttcctggaccagatcaaccagcggcag
gaaagtctgcctcacgcagggcccatcatcgtgcactgcagcgccggcatcggccgcaca
ggcaccatcattgtcatcgacatgctcatggagaacatctccaccaagggcctggactgt
gacattgacatccagaagaccatccagatggtgcgggcgcagcgctcgggcatggtgcag
acggaggcgcagtacaagttcatctacgtggccatcgcccagttcattgaaaccactaag
aagaagctggaggtcctgcagtcgcagaagggccaggagtcggagtacgggaacatcacc
tatcccccagccatgaagaatgcccatgccaaggcctcccgcacctcgtccaaacacaag
gaggatgtgtatgagaacctgcacactaagaacaagagggaggagaaagtgaagaagcag
cggtcagcagacaaggagaagagcaagggttccctcaagaggaagtga

DBGET integrated database retrieval system