KEGG   Homo sapiens (human): 5777Help
Entry
5777              CDS       T01001                                 

Gene name
PTPN6, HCP, HCPH, HPTP1C, PTP-1C, SH-PTP1, SHP-1, SHP-1L, SHP1
Definition
protein tyrosine phosphatase, non-receptor type 6 (EC:3.1.3.48)
Orthology
K05697  
tyrosine-protein phosphatase non-receptor type 6 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Leishmaniasis
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5777 (PTPN6)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    5777 (PTPN6)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    5777 (PTPN6)
   04660 T cell receptor signaling pathway
    5777 (PTPN6)
   04662 B cell receptor signaling pathway
    5777 (PTPN6)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5777 (PTPN6)
  Infectious diseases
   05140 Leishmaniasis
    5777 (PTPN6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5777 (PTPN6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 595 aa AA seqDB search
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
LETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRNK
CVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNIT
YPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggtggtttcaccgagacctcagtgggctggatgcagagaccctgctcaagggc
cgaggtgtccacggtagcttcctggctcggcccagtcgcaagaaccagggtgacttctcg
ctctccgtcagggtgggggatcaggtgacccatattcggatccagaactcaggggatttc
tatgacctgtatggaggggagaagtttgcgactctgacagagctggtggagtactacact
cagcagcagggtgtcctgcaggaccgcgacggcaccatcatccacctcaagtacccgctg
aactgctccgatcccactagtgagaggtggtaccatggccacatgtctggcgggcaggca
gagacgctgctgcaggccaagggcgagccctggacgtttcttgtgcgtgagagcctcagc
cagcctggagacttcgtgctttctgtgctcagtgaccagcccaaggctggcccaggctcc
ccgctcagggtcacccacatcaaggtcatgtgcgagggtggacgctacacagtgggtggt
ttggagaccttcgacagcctcacggacctggtggagcatttcaagaagacggggattgag
gaggcctcaggcgcctttgtctacctgcggcagccgtactatgccacgagggtgaatgcg
gctgacattgagaaccgagtgttggaactgaacaagaagcaggagtccgaggatacagcc
aaggctggcttctgggaggagtttgagagtttgcagaagcaggaggtgaagaacttgcac
cagcgtctggaagggcagcggccagagaacaagggcaagaaccgctacaagaacattctc
ccctttgaccacagccgagtgatcctgcagggacgggacagtaacatccccgggtccgac
tacatcaatgccaactacatcaagaaccagctgctaggccctgatgagaacgctaagacc
tacatcgccagccagggctgtctggaggccacggtcaatgacttctggcagatggcgtgg
caggagaacagccgtgtcatcgtcatgaccacccgagaggtggagaaaggccggaacaaa
tgcgtcccatactggcccgaggtgggcatgcagcgtgcttatgggccctactctgtgacc
aactgcggggagcatgacacaaccgaatacaaactccgtaccttacaggtctccccgctg
gacaatggagacctgattcgggagatctggcattaccagtacctgagctggcccgaccat
ggggtccccagtgagcctgggggtgtcctcagcttcctggaccagatcaaccagcggcag
gaaagtctgcctcacgcagggcccatcatcgtgcactgcagcgccggcatcggccgcaca
ggcaccatcattgtcatcgacatgctcatggagaacatctccaccaagggcctggactgt
gacattgacatccagaagaccatccagatggtgcgggcgcagcgctcgggcatggtgcag
acggaggcgcagtacaagttcatctacgtggccatcgcccagttcattgaaaccactaag
aagaagctggaggtcctgcagtcgcagaagggccaggagtcggagtacgggaacatcacc
tatcccccagccatgaagaatgcccatgccaaggcctcccgcacctcgtccaaacacaag
gaggatgtgtatgagaacctgcacactaagaacaagagggaggagaaagtgaagaagcag
cggtcagcagacaaggagaagagcaagggttccctcaagaggaagtga

DBGET integrated database retrieval system