KEGG   Homo sapiens (human): 57787Help
Entry
57787             CDS       T01001                                 

Gene name
MARK4, MARK4L, MARK4S, MARKL1, MARKL1L, PAR-1D
Definition
(RefSeq) microtubule affinity regulating kinase 4 (EC:2.7.11.1)
  KO
K08798  
MAP/microtubule affinity-regulating kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     57787 (MARK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   57787 (MARK4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     57787 (MARK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.3
AA seq 752 aa AA seqDB search
MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYR
LLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVK
LFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR
DLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIW
SLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEV
TATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAH
NPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVP
PASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHE
AAPLPAGRPRPTTNLFTKLTSKLTRRVADEPERIGGPEVTSCHLPWDQTETAPRLLRFPW
SVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLP
RPGLRGVLFRRVAGTALAFRTLVTRISNDLEL
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcggacggtgctggccccgggcaacgatcggaactcggacacgcatggcacc
ttgggcagtggccgctcctcggacaaaggcccgtcctggtccagccgctcactgggtgcc
cgttgccggaactccatcgcctcctgtcccgaggagcagccccacgtgggcaactaccgc
ctgctgaggaccattgggaagggcaactttgccaaagtcaagctggctcggcacatcctc
actggtcgggaggttgccatcaagattatcgacaaaacccagctgaatcccagcagcctg
cagaagctgttccgagaagtccgcatcatgaagggcctaaaccaccccaacatcgtgaag
ctctttgaggtgattgagactgagaagacgctgtacctggtgatggagtacgcaagtgct
ggagaagtgtttgactacctcgtgtcgcatggccgcatgaaggagaaggaagctcgagcc
aagttccgacagattgtttcggctgtgcactattgtcaccagaaaaatattgtacacagg
gacctgaaggctgagaacctcttgctggatgccgaggccaacatcaagattgctgacttt
ggcttcagcaacgagttcacgctgggatcgaagctggacacgttctgcgggagcccccca
tatgccgccccggagctgtttcagggcaagaagtacgacgggccggaggtggacatctgg
agcctgggagtcatcctgtacaccctcgtcagcggctccctgcccttcgacgggcacaac
ctcaaggagctgcgggagcgagtactcagagggaagtaccgggtccctttctacatgtca
acagactgtgagagcatcctgcggagatttttggtgctgaacccagctaaacgctgtact
ctcgagcaaatcatgaaagacaaatggatcaacatcggctatgagggtgaggagttgaag
ccatacacagagcccgaggaggacttcggggacaccaagagaattgaggtgatggtgggt
atgggctacacacgggaagaaatcaaagagtccttgaccagccagaagtacaacgaagtg
accgccacctacctcctgctgggcaggaagactgaggagggtggggaccggggcgcccca
gggctggccctggcacgggtgcgggcgcccagcgacaccaccaacggaacaagttccagc
aaaggcaccagccacagcaaagggcagcggagttcctcttccacctaccaccgccagcgc
aggcatagcgatttctgtggcccatcccctgcacccctgcaccccaaacgcagcccgacg
agcacgggggaggcggagctgaaggaggagcggctgccaggccggaaggcgagctgcagc
accgcggggagtgggagtcgagggctgcccccctccagccccatggtcagcagcgcccac
aaccccaacaaggcagagatcccagagcggcggaaggacagcacgagcacccccaacaac
ctccctcctagcatgatgacccgcagaaacacctacgtttgcacagaacgcccgggggct
gagcgcccgtcactgttgccaaatgggaaagaaaacagctcaggcaccccacgggtgccc
cctgcctccccctccagtcacagcctggcacccccatcaggggagcggagccgcctggca
cgcggttccaccatccgcagcaccttccatggtggccaggtccgggaccggcgggcaggg
ggtgggggtggtgggggtgtgcagaatgggccccctgcctctcccacactggcccatgag
gctgcacccctgcccgccgggcggccccgccccaccaccaacctcttcaccaagctgacc
tccaaactgacccgaagggtcgcagacgaacctgagagaatcgggggacctgaggtcaca
agttgccatctaccttgggatcaaacggaaaccgccccccggctgctccgattcccctgg
agtgtgaagctgaccagctcgcgccctcctgaggccctgatggcagctctgcgccaggcc
acagcagccgcccgctgccgctgccgccagccacagccgttcctgctggcctgcctgcac
gggggtgcgggcgggcccgagcccctgtcccacttcgaagtggaggtctgccagctgccc
cggccaggcttgcggggagttctcttccgccgtgtggcgggcaccgccctggccttccgc
accctcgtcacccgcatctccaacgacctcgagctctga

DBGET integrated database retrieval system