KEGG   Homo sapiens (human): 578Help
Entry
578               CDS       T01001                                 

Gene name
BAK1, BAK, BAK-LIKE, BCL2L7, CDN1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  
Bcl-2 homologous antagonist/killer
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    578 (BAK1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    578 (BAK1)
   04215 Apoptosis - multiple species
    578 (BAK1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    578 (BAK1)
   05206 MicroRNAs in cancer
    578 (BAK1)
   05203 Viral carcinogenesis
    578 (BAK1)
   05210 Colorectal cancer
    578 (BAK1)
   05212 Pancreatic cancer
    578 (BAK1)
   05214 Glioma
    578 (BAK1)
   05216 Thyroid cancer
    578 (BAK1)
   05220 Chronic myeloid leukemia
    578 (BAK1)
   05217 Basal cell carcinoma
    578 (BAK1)
   05218 Melanoma
    578 (BAK1)
   05213 Endometrial cancer
    578 (BAK1)
   05224 Breast cancer
    578 (BAK1)
   05222 Small cell lung cancer
    578 (BAK1)
   05223 Non-small cell lung cancer
    578 (BAK1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    578 (BAK1)
   05165 Human papillomavirus infection
    578 (BAK1)
  Drug resistance
   01524 Platinum drug resistance
    578 (BAK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    578 (BAK1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   578 (BAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16611(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 211 aa AA seqDB search
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggtggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag
agtggcatcaattggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcatggcctgactggcttcctaggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system