KEGG   Homo sapiens (human): 578Help
Entry
578               CDS       T01001                                 

Gene name
BAK1, BAK, BAK-LIKE, BCL2L7, CDN1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  
Bcl-2 homologous antagonist/killer
Organism
hsa  Homo sapiens (human)
Pathway
Platinum drug resistance
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Viral carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    578 (BAK1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    578 (BAK1)
   04215 Apoptosis - multiple species
    578 (BAK1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    578 (BAK1)
   05203 Viral carcinogenesis
    578 (BAK1)
  Antineoplastic resistance
   01524 Platinum drug resistance
    578 (BAK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    578 (BAK1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   578 (BAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 211 aa AA seqDB search
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggtggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag
agtggcatcaattggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcatggcctgactggcttcctaggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system