KEGG   Homo sapiens (human): 578Help
Entry
578               CDS       T01001                                 

Gene name
BAK1, BAK, BAK-LIKE, BCL2L7, CDN1
Definition
BCL2-antagonist/killer 1
Orthology
K14021  
Bcl-2 homologous antagonist/killer
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Viral carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    578 (BAK1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    578 (BAK1)
   05203 Viral carcinogenesis
    578 (BAK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    578 (BAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 211 aa AA seqDB search
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggtggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag
agtggcatcaattggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcatggcctgactggcttcctaggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system