KEGG   Homo sapiens (human): 57801Help
Entry
57801             CDS       T01001                                 

Gene name
HES4, bHLHb42
Definition
(RefSeq) hes family bHLH transcription factor 4
  KO
K09089  
hairy and enhancer of split 4
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    57801 (HES4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.33
AA seq 221 aa AA seqDB search
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTL
ILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAE
VNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLP
SLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagacacgccggggaaaccgagcgcctcgccgatggcaggagcgccggccagc
gccagccggaccccagacaagccccggagcgcggccgagcaccgcaagtcctccaagccg
gtcatggagaagcggcgccgagcgcgtattaacgagagcctcgctcagctcaaaaccctc
atcctggacgccctcagaaaagagagctcccgccactcgaagctggagaaggcggacatc
ctggagatgaccgtgagacacctgcggagcctgcgtcgcgtgcaggtgacggccgcgctc
agcgccgaccccgccgttctgggcaagtaccgcgccggcttccacgagtgtctggcggag
gtgaaccgcttcctggccggctgcgagggcgtcccggccgacgtgcgctcccgcctgctg
ggccacctggcagcctgcctgcgccagctgggaccctcccgccgcccggcctcgctgtcc
ccggctgcccccgcagaggccccagcgcccgaggtctacgcgggccgcccgctgctgcca
tcgctcggcggccccttccctctgctcgcgccgccgctgctgccgggtctgacccgggcg
ctgcccgccgcccccagggcggggccgcagggcccgggtgggccctggaggccgtggctg
cgctga

DBGET integrated database retrieval system