KEGG   Homo sapiens (human): 57804Help
Entry
57804             CDS       T01001                                 

Gene name
POLD4, POLDS, p12
Definition
polymerase (DNA-directed), delta 4, accessory subunit
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    57804 (POLD4)
   00240 Pyrimidine metabolism
    57804 (POLD4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    57804 (POLD4)
   03410 Base excision repair
    57804 (POLD4)
   03420 Nucleotide excision repair
    57804 (POLD4)
   03430 Mismatch repair
    57804 (POLD4)
   03440 Homologous recombination
    57804 (POLD4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    57804 (POLD4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      57804 (POLD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q13
AA seq 79 aa AA seqDB search
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGP
CTVSGISIPYEAPRKTSCP
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgattcctacccggttgtgaagaggagggaggggccc
gctgggcacagcaagggggagctggcacccgagctaggggaggagccccagccccgcgac
gaggaggaagcggagctggagctgctgaggcagtttgacctggcctggcagtacgggccc
tgcaccgtctctggcatctctatcccctatgaggcaccacgtaagacctcctgcccttag

DBGET integrated database retrieval system