KEGG   Homo sapiens (human): 57817Help
Entry
57817             CDS       T01001                                 

Gene name
HAMP, HEPC, HFE2B, LEAP1, PLTR
Definition
(RefSeq) hepcidin antimicrobial peptide
Organism
hsa  Homo sapiens (human)
Disease
H00211  Hemochromatosis (HFE)
SSDB OrthologParalogGFIT
Motif
Pfam: Hepcidin
Motif
Other DBs
NCBI-GeneID: 57817
NCBI-ProteinID: NP_066998
OMIM: 606464
HGNC: 15598
Ensembl: ENSG00000105697
Vega: OTTHUMG00000183295
Pharos: P81172(Tbio)
UniProt: P81172
Structure
PDB: 

Jmol
Position
19q13.12
AA seq 84 aa AA seqDB search
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggcactgagctcccagatctgggccgcttgcctcctgctcctcctcctcctcgccagc
ctgaccagtggctctgttttcccacaacagacgggacaacttgcagagctgcaaccccag
gacagagctggagccagggccagctggatgcccatgttccagaggcgaaggaggcgagac
acccacttccccatctgcattttctgctgcggctgctgtcatcgatcaaagtgtgggatg
tgctgcaagacgtag

DBGET integrated database retrieval system