KEGG   Homo sapiens (human): 57817Help
Entry
57817             CDS       T01001                                 

Gene name
HAMP, HEPC, HFE2B, LEAP1, PLTR
Definition
hepcidin antimicrobial peptide
Organism
hsa  Homo sapiens (human)
Disease
H00211  
Hemochromatosis (HFE)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 84 aa AA seqDB search
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggcactgagctcccagatctgggccgcttgcctcctgctcctcctcctcctcgccagc
ctgaccagtggctctgttttcccacaacagacgggacaacttgcagagctgcaaccccag
gacagagctggagccagggccagctggatgcccatgttccagaggcgaaggaggcgagac
acccacttccccatctgcattttctgctgcggctgctgtcatcgatcaaagtgtgggatg
tgctgcaagacgtag

DBGET integrated database retrieval system