KEGG   Homo sapiens (human): 57817Help
Entry
57817             CDS       T01001                                 

Gene name
HAMP, HEPC, HFE2B, LEAP1, PLTR
Definition
hepcidin antimicrobial peptide
Organism
hsa  Homo sapiens (human)
Disease
H00211  
Hemochromatosis (HFE)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 84 aa AA seqDB search
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggcactgagctcccagatctgggccgcttgcctcctgctcctcctcctcctcgccagc
ctgaccagtggctctgttttcccacaacagacgggacaacttgcagagctgcaaccccag
gacagagctggagccagggccagctggatgcccatgttccagaggcgaaggaggcgagac
acccacttccccatctgcattttctgctgcggctgctgtcatcgatcaaagtgtgggatg
tgctgcaagacgtag

DBGET integrated database retrieval system