KEGG   Homo sapiens (human): 57818Help
Entry
57818             CDS       T01001                                 

Gene name
G6PC2, IGRP
Definition
glucose-6-phosphatase, catalytic, 2 (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    57818 (G6PC2)
   00052 Galactose metabolism
    57818 (G6PC2)
   00500 Starch and sucrose metabolism
    57818 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    57818 (G6PC2)
   04151 PI3K-Akt signaling pathway
    57818 (G6PC2)
   04152 AMPK signaling pathway
    57818 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    57818 (G6PC2)
   04920 Adipocytokine signaling pathway
    57818 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    57818 (G6PC2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     57818 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2q24.3
AA seq 154 aa AA seqDB search
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRHAGGRGL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcacaggaatggagtgctcataattcagcatttgcagaaggactaccga
gcttactacacttttctaaattttatgtccaatgttggagaccccaggaatatctttttc
atttattttccactttgttttcaatttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggattggttaaatcttatatttaaatggatattatttggtcatcgacct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccctactacatgtgaaacaggtccaggaagtccatctggccatgcaatgggcgcatcc
tgtgtctggtatgtcatggtaaccgctgccctgagccacactgtctgtgggatggataag
ttctctatcactctgcacaggcatgctggtggcagaggcctttga

DBGET integrated database retrieval system