KEGG   Homo sapiens (human): 57818Help
Entry
57818             CDS       T01001                                 

Gene name
G6PC2, IGRP
Definition
glucose-6-phosphatase, catalytic, 2 (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hsa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hsa00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2q24.3
AA seq 154 aa AA seqDB search
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRHAGGRGL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcacaggaatggagtgctcataattcagcatttgcagaaggactaccga
gcttactacacttttctaaattttatgtccaatgttggagaccccaggaatatctttttc
atttattttccactttgttttcaatttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggattggttaaatcttatatttaaatggatattatttggtcatcgacct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccctactacatgtgaaacaggtccaggaagtccatctggccatgcaatgggcgcatcc
tgtgtctggtatgtcatggtaaccgctgccctgagccacactgtctgtgggatggataag
ttctctatcactctgcacaggcatgctggtggcagaggcctttga

DBGET integrated database retrieval system