KEGG   Homo sapiens (human): 57818Help
Entry
57818             CDS       T01001                                 

Gene name
G6PC2, IGRP
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    57818 (G6PC2)
   00052 Galactose metabolism
    57818 (G6PC2)
   00500 Starch and sucrose metabolism
    57818 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    57818 (G6PC2)
   04151 PI3K-Akt signaling pathway
    57818 (G6PC2)
   04152 AMPK signaling pathway
    57818 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    57818 (G6PC2)
   04922 Glucagon signaling pathway
    57818 (G6PC2)
   04920 Adipocytokine signaling pathway
    57818 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    57818 (G6PC2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    57818 (G6PC2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     57818 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 57818
NCBI-ProteinID: NP_066999
OMIM: 608058
HGNC: 28906
Ensembl: ENSG00000152254
Vega: OTTHUMG00000132182
Pharos: Q9NQR9(Tbio)
UniProt: Q9NQR9
Position
2q31.1
AA seq 355 aa AA seqDB search
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcacaggaatggagtgctcataattcagcatttgcagaaggactaccga
gcttactacacttttctaaattttatgtccaatgttggagaccccaggaatatctttttc
atttattttccactttgttttcaatttaatcagacagttggaaccaagatgatatgggta
gcagtcattggggattggttaaatcttatatttaaatggatattatttggtcatcgacct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccctactacatgtgaaacaggtccaggaagtccatctggccatgcaatgggcgcatcc
tgtgtctggtatgtcatggtaaccgctgccctgagccacactgtctgtgggatggataag
ttctctatcactctgcacagactgacctggtcatttctttggagtgttttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgctggtggcagaggcctttgaacacactccaggcatccaa
acggccagtctgggcacatacctgaagaccaacctctttctcttcctgtttgcagttggc
ttttacctgcttcttagggtgctcaacattgacctgctgtggtccgtgcccatagccaaa
aagtggtgtgctaaccccgactggatccacattgacaccacgccttttgctggactcgtg
agaaaccttggggtcctctttggcttgggctttgcaatcaactcagagatgttcctcctg
agctgccgagggggaaataactacacactgagcttccggttgctctgtgccttgacctca
ttgacaatactgcagctctaccatttcctccagatcccgactcacgaagagcatttattt
tatgtgctgtctttttgtaaaagtgcatccattcccctaactgtggttgctttcattccc
tactctgttcatatgttaatgaaacaaagcggaaagaagagtcagtag

DBGET integrated database retrieval system