KEGG   Homo sapiens (human): 57834Help
Entry
57834             CDS       T01001                                 

Gene name
CYP4F11, CYPIVF11
Definition
cytochrome P450, family 4, subfamily F, polypeptide 11 (EC:1.14.14.1)
Orthology
K17729  
cytochrome P450, family 4, subfamily F, polypeptide 11 [EC:1.14.14.1]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 524 aa AA seqDB search
MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWF
WGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPK
DMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR
LASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL
LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID
VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQE
LLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgagcctgtcctggctgggcctcgggcccgtggcagcatccccgtggctg
cttctgctgctggttgggggctcctggctcctggcccgcgtcctggcctggacctacacc
ttctatgacaactgccgccgcctccagtgttttcctcaacccccgaaacagaactggttt
tggggacaccagggcctggtcactcccacggaagagggcatgaagacattgacccagctg
gtgaccacatatccccagggctttaagttgtggctgggtcctaccttccccctcctcatt
ttatgccaccctgacattatccggcctatcaccagtgcctcagctgctgtcgcacccaag
gatatgattttctatggcttcctgaagccctggctgggggatgggctcctgctgagtggt
ggtgacaagtggagccgccaccgtcggatgttgacgcctgccttccatttcaacatcttg
aagccttatatgaagattttcaacaagagtgtgaacatcatgcacgacaagtggcagcgc
ctggcctcagagggcagcgccagactggacatgtttgaacacatcagcctcatgaccttg
gacagtctgcagaaatgtgtcttcagctttgaaagcaattgtcaggagaagcccagtgaa
tatattgccgccatcttggagctcagtgcctttgtagaaaagagaaaccagcagattctc
ttgcacacggacttcctgtattatctcactcctgatgggcagcgcttccgcagggcctgc
cacctggtgcacgacttcacagatgccgtcatccaggagcggcgctgcaccctccccact
cagggtattgatgatttcctcaagaacaaggcaaagtccaagactttagacttcattgat
gtgcttctgctgagcaaggatgaagatgggaaggaattgtctgatgaggacataagagca
gaagctgacaccttcatgtttgagggccatgacactacagccagtggtctctcctgggtc
ctataccaccttgcaaagcacccagaataccaggaacagtgccggcaagaagtgcaagag
cttctgaaggaccgtgaacctatagagattgaatgggacgacctggcccagctgcccttc
ctgaccatgtgcattaaggagagcctgcggttgcatcccccagtcccggtcatctcccga
tgttgcacgcaggactttgtgctcccagacggccgcgtcatccccaaaggcattgtctgc
ctcatcaatattatcgggatccattacaacccaactgtgtggccagaccctgaggtctac
gaccccttccgtttcgaccaagagaacatcaaggagaggtcacctctggcttttattccc
ttctcggcagggcccagaaactgcatcgggcaggcgttcgccatggctgagatgaaggtg
gtcctggcgctcaccctgctgcacttccgcatcctgccgacccacactgaaccccgcagg
aaacccgagctgatattgcgcgcagagggtggactttggctgcgggtggagcccctgggt
gcgaactcacagtga

DBGET integrated database retrieval system