KEGG   Homo sapiens (human): 57834Help
Entry
57834             CDS       T01001                                 

Gene name
CYP4F11, CYPIVF11
Definition
cytochrome P450, family 4, subfamily F, polypeptide 11 (EC:1.14.14.1)
Orthology
K17729  
cytochrome P450, family 4, subfamily F, polypeptide 11 [EC:1.14.14.1 1.14.13.194]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.194  phylloquinone omega-hydroxylase
     57834 (CYP4F11)
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     57834 (CYP4F11)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   57834 (CYP4F11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 524 aa AA seqDB search
MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWF
WGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPK
DMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR
LASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL
LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID
VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQE
LLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgagcctgtcctggctgggcctcgggcccgtggcagcatccccgtggctg
cttctgctgctggttgggggctcctggctcctggcccgcgtcctggcctggacctacacc
ttctatgacaactgccgccgcctccagtgttttcctcaacccccgaaacagaactggttt
tggggacaccagggcctggtcactcccacggaagagggcatgaagacattgacccagctg
gtgaccacatatccccagggctttaagttgtggctgggtcctaccttccccctcctcatt
ttatgccaccctgacattatccggcctatcaccagtgcctcagctgctgtcgcacccaag
gatatgattttctatggcttcctgaagccctggctgggggatgggctcctgctgagtggt
ggtgacaagtggagccgccaccgtcggatgttgacgcctgccttccatttcaacatcttg
aagccttatatgaagattttcaacaagagtgtgaacatcatgcacgacaagtggcagcgc
ctggcctcagagggcagcgccagactggacatgtttgaacacatcagcctcatgaccttg
gacagtctgcagaaatgtgtcttcagctttgaaagcaattgtcaggagaagcccagtgaa
tatattgccgccatcttggagctcagtgcctttgtagaaaagagaaaccagcagattctc
ttgcacacggacttcctgtattatctcactcctgatgggcagcgcttccgcagggcctgc
cacctggtgcacgacttcacagatgccgtcatccaggagcggcgctgcaccctccccact
cagggtattgatgatttcctcaagaacaaggcaaagtccaagactttagacttcattgat
gtgcttctgctgagcaaggatgaagatgggaaggaattgtctgatgaggacataagagca
gaagctgacaccttcatgtttgagggccatgacactacagccagtggtctctcctgggtc
ctataccaccttgcaaagcacccagaataccaggaacagtgccggcaagaagtgcaagag
cttctgaaggaccgtgaacctatagagattgaatgggacgacctggcccagctgcccttc
ctgaccatgtgcattaaggagagcctgcggttgcatcccccagtcccggtcatctcccga
tgttgcacgcaggactttgtgctcccagacggccgcgtcatccccaaaggcattgtctgc
ctcatcaatattatcgggatccattacaacccaactgtgtggccagaccctgaggtctac
gaccccttccgtttcgaccaagagaacatcaaggagaggtcacctctggcttttattccc
ttctcggcagggcccagaaactgcatcgggcaggcgttcgccatggctgagatgaaggtg
gtcctggcgctcaccctgctgcacttccgcatcctgccgacccacactgaaccccgcagg
aaacccgagctgatattgcgcgcagagggtggactttggctgcgggtggagcccctgggt
gcgaactcacagtga

DBGET integrated database retrieval system