KEGG   Homo sapiens (human): 57835Help
Entry
57835             CDS       T01001                                 

Gene name
SLC4A5, NBC4
Definition
solute carrier family 4 (sodium bicarbonate cotransporter), member 5
Orthology
K13857  
solute carrier family 4 (sodium bicarbonate cotransporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    57835 (SLC4A5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   57835 (SLC4A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13
AA seq 1137 aa AA seqDB search
MKVKEEKAGVGKLDHTNHRRRFPDQKECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWG
LRPDQPQQELTGPGSGASSQDSSMDLISRTRSPAAEQLQDILGEEDEAPNPTLFTEMDTL
QHDGDQMEWKESARWIKFEEKVEEGGERWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDS
GSLPQIIDDVIEKQIEDGLLRPELRERVSYVLLRRHRHQTKKPIHRSLADIGKSVSTTNR
SPARSPGAGPSLHHSTEDLRMRQSANYGRLCHAQSRSMNDISLTPNTDQRKNKFMKKIPK
DSEASNVLVGEVDFLDQPFIAFVRLIQSAMLGGVTEVPVPTRFLFILLGPSGRAKSYNEI
GRAIATLMVDDLFSDVAYKARNREDLIAGIDEFLDEVIVLPPGEWDPNIRIEPPKKVPSA
DKRKSVFSLAELGQMNGSVGGGGGAPGGGNGGGGGGGSGGGAGSGGAGGTSSGDDGEMPA
MHEIGEELIWTGRFFGGLCLDIKRKLPWFPSDFYDGFHIQSISAILFIYLGCITNAITFG
GLLGDATDNYQGVMESFLGTAMAGSLFCLFSGQPLIILSSTGPILIFEKLLFDFSKGNGL
DYMEFRLWIGLHSAVQCLILVATDASFIIKYITRFTEEGFSTLISFIFIYDAIKKMIGAF
KYYPINMDFKPNFITTYKCECVAPDTVNTTVFNASAPLAPDTNASLYNLLNLTALDWSLL
SKKECLSYGGRLLGNSCKFIPDLALMSFILFFGTYSMTLTLKKFKFSRYFPTKVRALVAD
FSIVFSILMFCGIDACFGLETPKLHVPSVIKPTRPDRGWFVAPFGKNPWWVYPASILPAL
LVTILIFMDQQITAVIVNRKENKLKKAAGYHLDLFWVGILMALCSFMGLPWYVAATVISI
AHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPILKCIPLPVLYGVF
LYMGVASLNGIQMGTGGSEFKIQKKLTPFWERCKLFLMPAKHQPDHAFLRHVPLRRIHLF
TLVQILCLAVLWILKSTVAAIIFPVMILGLIIVRRLLDFIFSQHDLAWIDNILPEKEKKE
TDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaaggaggagaaggctggggtaggaaagctggaccacactaaccacaggagg
agatttccggatcagaaagaatgccctcctatccacattgggcttccagtacccacttac
cctcaaagaaaaactgaccagaagggacatctttcaggcctgcaaaaagtccactggggc
ctgcggccagaccagccacagcaggaactgactggcccagggagtggggcaagcagccag
gacagcagcatggatcttatcagcaggactcggtccccagctgctgagcagctccaggac
atcctgggggaggaagatgaggctcccaaccccaccctctttacagagatggatactctg
cagcatgacggagaccagatggagtggaaggagtcagccaggtggataaagtttgaagaa
aaggtagaggaaggcggcgaacgctggagcaagccccacgtgtccacactatccctgcac
agcctcttcgagctccgtacctgcctgcagacggggacggtgctgctggatttggacagt
ggctccttaccacagatcatagatgatgtcattgagaagcagattgaggatggtctcctg
cggccagagctccgggagagggtcagttacgtcctcctgaggaggcaccgccaccaaacc
aagaagcccatccaccgctccttagctgacattgggaagtcagtctccaccacaaatcgc
agtcctgcccggagccctggtgctggcccgagtctacaccactccacggaagacctgcgg
atgcggcagagtgcaaattacggacgtctgtgtcatgcccagagcagaagcatgaatgac
atttctctcaccccaaacacagaccagcggaaaaacaaattcatgaagaagatccccaag
gactcagaagcgtccaacgtgctcgtgggcgaggtggacttcctagaccagccattcatc
gcgttcgtgcgcctcatccagtcggccatgctgggaggagtgaccgaggtgcctgtcccc
accagatttctgtttatactactgggaccttctgggagagcaaaatcctacaatgaaatt
ggccgtgccattgcaaccctcatggtagatgatctcttcagtgacgtggcctacaaagcc
cgcaatcgggaagatctgatcgcaggaattgatgaatttctggatgaggtcatcgtcctt
cctcctggagaatgggacccaaatatccggattgagccccccaagaaggtgccctctgct
gacaagaggaaatctgtgttctccctagcagagctgggccagatgaatggctctgtggga
ggaggcggcggagctcctggaggaggcaatggaggtggtggtggtggtggcagtggcggc
ggggctggcagtggcggggccggcggaacaagcagcggggatgatggagagatgccagcc
atgcatgaaatcggggaggaacttatctggacaggaaggttcttcggtggcctgtgtctg
gatatcaagaggaagttgccctggttcccaagtgacttctatgatggcttccacattcag
tccatctctgccatcctattcatctacctcggctgtatcaccaacgcgatcacctttggt
gggcttctgggggatgccaccgacaattatcagggagtgatggagagcttcctgggcact
gccatggctggctccttgttctgcctcttctcgggacagcctctcatcattctcagcagc
acggggcccatcctcatctttgagaagctcctcttcgacttcagcaaaggcaatggcctg
gactacatggagttccgcctctggattggcctacactcagctgtccagtgccttatccta
gtggccacagatgccagctttatcatcaaatatatcacccgcttcaccgaggagggcttc
tccacccttatcagcttcatcttcatctacgatgccatcaagaagatgatcggtgccttc
aagtactaccctatcaatatggacttcaagccaaacttcatcactacctacaagtgcgag
tgtgtcgcccctgacacagtgaatacaaccgtgttcaatgcttcagccccattggcacca
gacaccaacgcttctctgtacaacctccttaacctcacagcgttggactggtccctgctg
agcaagaaggagtgtctgagctacggcgggcgcctgcttgggaattcctgcaagtttatc
ccagacctggcgctcatgtccttcatccttttctttgggacatactccatgaccctgacc
ctgaagaagttcaaattcagccgctattttcctaccaaggtccgggccctggtggctgac
ttttccattgttttctccatcctgatgttctgtggaatcgatgcctgttttggcctagaa
actcccaagctgcatgtgcccagtgtcatcaagccaacgcggcctgaccgaggctggttc
gtggccccctttgggaagaacccgtggtgggtatacccagcaagcatcctgcccgccctg
ctggtgaccatcctgatcttcatggaccagcagatcactgccgtcattgtcaaccggaag
gagaacaaactgaagaaggctgccggctaccatctggacctgttctgggtgggcatcctc
atggctttgtgctcctttatggggctcccctggtacgtggctgccacggtcatctccatc
gcccacatcgacagcctcaagatggagacagagaccagtgcccctggggagcagccccag
tttctgggagtcagggaacagagagtaaccggcatcatcgtcttcatcctgacgggaatc
tctgtcttcctggctcccatcctaaagtgtatccccctgccggtgctgtacggagtcttc
ctctacatgggcgtggcctccctgaatggcatccagatggggaccggagggtcagaattc
aaaatccagaagaagctgactccattctgggaacgctgcaagctcttcctgatgccagcc
aagcaccagccggaccatgccttcctgcggcacgtgccgctgcgccggatccacctcttc
accctggtgcagatcctctgcctggcggtgctctggatcctcaaatccacggtggctgcc
atcatcttcccggtcatgatcctgggcctcatcatcgttcgaaggcttctggatttcatc
ttttcccagcacgacctggcctggattgacaacatcctcccagagaaggaaaaaaaggag
acagacaagaagaggaagagaaaaaaaggggcccacgaggactgtgatgaggagccccag
ttccctcctccctcggttataaagattcccatggaaagtgtccaatcagatccccaaaac
ggtatccactgcattgccagaaaaagatcttccagttggagttactcactctga

DBGET integrated database retrieval system