KEGG   Homo sapiens (human): 5792Help
Entry
5792              CDS       T01001                                 

Gene name
PTPRF, BNAH2, LAR
Definition
(RefSeq) protein tyrosine phosphatase, receptor type F
  KO
K05695  
receptor-type tyrosine-protein phosphatase F [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Adherens junction
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5792 (PTPRF)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    5792 (PTPRF)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5792 (PTPRF)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5792 (PTPRF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5792 (PTPRF)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5792 (PTPRF)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   N/0 subfamily
    LRRC4B, NGL3; netrin-G3 ligand [KO:K16360]
     5792 (PTPRF)
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     5792 (PTPRF)
 4. Link Protein Family
  AGC1, CSPG1; aggrecan 1 [KO:K06792]
   5792 (PTPRF)
  VCAN, CSPG2; versican core protein [KO:K06793]
   5792 (PTPRF)
  NCAN, CSPG3; neurocan core protein [KO:K06794]
   5792 (PTPRF)
  CSPG4; chondroitin sulfate proteoglycan 4 [KO:K08115]
   5792 (PTPRF)
  BCAN; brevican [KO:K06795]
   5792 (PTPRF)
  PTPRZ; receptor-type tyrosine-protein phosphatase zeta [KO:K08114]
   5792 (PTPRF)
 7. Others
  SDC2; syndecan 2 [KO:K16336]
   5792 (PTPRF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P10586(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.2
AA seq 1907 aa AA seqDB search
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IMYELVYWAAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEAQWRPEESEDY
ETTISGLTPETTYSVTVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMNTALLQW
HPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGL
GEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINS
QQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRV
AAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNR
GSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPID
RVGGSMLTPRWSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTL
GDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPE
MLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLN
YQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNR
YANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWE
QRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGS
SEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIV
IDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNL
YAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTR
VCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTK
LREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQF
TDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMR
YEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
NT seq 5724 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgagccagccccagggaggacgatggtgccccttgtgcctgcactggtgatg
cttggtttggtggcaggcgcccatggtgacagcaaacctgtcttcattaaagtccctgag
gaccagactgggctgtcaggaggggtagcctccttcgtgtgccaagctacaggagaaccc
aagccgcgcatcacatggatgaagaaggggaagaaagtcagctcccagcgcttcgaggtc
attgagtttgatgatggggcagggtcagtgcttcggatccagccattgcgggtgcagcga
gatgaagccatctatgagtgtacagctactaacagcctgggtgagatcaacactagtgcc
aagctctcagtgctcgaagaggaacagctgccccctgggttcccttccatcgacatgggg
cctcagctgaaggtggtggagaaggcacgcacagccaccatgctatgtgccgcaggcgga
aatccagaccctgagatttcttggttcaaggacttccttcctgtagaccctgccacgagc
aacggccgcatcaagcagctgcgttcaggtgccttgcagatagagagcagtgaggaatcc
gaccaaggcaagtacgagtgtgtggcgaccaactcggcaggcacacgttactcagcccct
gcgaacctgtatgtgcgagtgcgccgcgtggctcctcgtttctccatccctcccagcagc
caggaggtgatgccaggcggcagcgtgaacctgacatgcgtggcagtgggtgcacccatg
ccctacgtgaagtggatgatgggggccgaggagctcaccaaggaggatgagatgccagtt
ggccgcaacgtcctggagctcagcaatgtcgtacgctctgccaactacacctgtgtggcc
atctcctcgctgggcatgatcgaggccacagcccaggtcacagtgaaagctcttccaaag
cctccgattgatcttgtggtgacagagacaactgccaccagtgtcaccctcacctgggac
tctgggaactcggagcctgtaacctactatggcatccagtaccgcgcagcgggcacggag
ggcccctttcaggaggtggatggtgtggccaccacccgctacagcattggcggcctcagc
cctttctcggaatatgccttccgcgtgctggcggtgaacagcatcgggcgagggccgccc
agcgaggcagtgcgggcacgcacgggagaacaggcgccctccagcccaccgcgccgcgtg
caggcacgcatgctgagcgccagcaccatgctggtgcagtgggagcctcccgaggagccc
aacggcctggtgcggggataccgcgtctactatactccggactcccgccgccccccgaac
gcctggcacaagcacaacaccgacgcggggctcctcacgaccgtgggcagcctgctgcct
ggcatcacctacagcctgcgcgtgcttgccttcaccgccgtgggcgatggccctcccagc
cccaccatccaggtcaagacgcagcagggagtgcctgcccagcccgcggacttccaggcc
gaggtggagtcggacaccaggatccagctctcgtggctgctgccccctcaggagcggatc
atcatgtatgaactggtgtactgggcggcagaggacgaagaccaacagcacaaggtgacc
ttcgacccaacctcctcctacacactagaggacctgaagcctgacacactctaccgcttc
cagctggctgcacgctcggatatgggggtgggcgtcttcacccccaccattgaggcccgc
acagcccagtccaccccctccgcccctccccagaaggtgatgtgtgtgagcatgggctcc
accacggtccgggtaagttgggtcccgccgcctgccgacagccgcaacggcgttatcacc
cagtactccgtggcctacgaggcggtggacggcgaggaccgcgggcggcatgtggtggat
ggcatcagccgtgagcactccagctgggacctggtgggcctggagaagtggacggagtac
cgggtgtgggtgcgggcacacacagacgtgggccccggccccgagagcagcccggtgctg
gtgcgcaccgatgaggacgtgcccagcgggcctccgcggaaggtggaggtggagccactg
aactccactgctgtgcatgtctactggaagctgcctgtccccagcaagcagcatggccag
atccgcggctaccaggtcacctacgtgcggctggagaatggcgagccccgtggactcccc
atcatccaagacgtcatgctagccgaggcccagtggcggccagaggagtccgaggactat
gaaaccactatcagcggcctgaccccggagaccacctactccgttactgttgctgcctat
accaccaagggggatggtgcccgcagcaagcccaaaattgtcactacaacaggtgcagtc
ccaggccggcccaccatgatgatcagcaccacggccatgaacactgcgctgctccagtgg
cacccacccaaggaactgcctggcgagctgctgggctaccggctgcagtactgccgggcc
gacgaggcgcggcccaacaccatagatttcggcaaggatgaccagcacttcacagtcacc
ggcctgcacaaggggaccacctacatcttccggcttgctgccaagaaccgggctggcttg
ggtgaggagttcgagaaggagatcaggacccccgaggacctgcccagcggcttcccccaa
aacctgcatgtgacaggactgaccacgtctaccacagaactggcctgggacccgccagtg
ctggcggagaggaacgggcgcatcatcagctacaccgtggtgttccgagacatcaacagc
caacaggagctgcagaacatcacgacagacacccgctttacccttactggcctcaagcca
gacaccacttacgacatcaaggtccgcgcatggaccagcaaaggctctggcccactcagc
cccagcatccagtcccggaccatgccggtggagcaagtgtttgccaagaacttccgggtg
gcggctgcaatgaagacgtctgtgctgctcagctgggaggttcccgactcctataagtca
gctgtgccctttaagattctgtacaatgggcagagtgtggaggtggacgggcactcgatg
cggaagctgatcgcagacctgcagcccaacacagagtactcgtttgtgctgatgaaccgt
ggcagcagcgcagggggcctgcagcacctggtgtccatccgcacagcccccgacctcctg
cctcacaagccgctgcctgcctctgcctacatagaggacggccgcttcgatctctccatg
ccccatgtgcaagacccctcgcttgtcaggtggttctacattgttgtggtgcccattgac
cgtgtgggcgggagcatgctgacgccaaggtggagcacacccgaggaactggagctggac
gagcttctagaagccatcgagcaaggcggagaggagcagcggcggcggcggcggcaggca
gaacgtctgaagccatatgtggctgctcaactggatgtgctcccggagacctttaccttg
ggggacaagaagaactaccggggcttctacaaccggcccctgtctccggacttgagctac
cagtgctttgtgcttgcctccttgaaggaacccatggaccagaagcgctatgcctccagc
ccctactcggatgagatcgtggtccaggtgacaccagcccagcagcaggaggagccggag
atgctgtgggtgacgggtcccgtgctggcagtcatcctcatcatcctcattgtcatcgcc
atcctcttgttcaaaaggaaaaggacccactctccgtcctctaaggatgagcagtcgatc
ggactgaaggactccttgctggcccactcctctgaccctgtggagatgcggaggctcaac
taccagaccccaggtatgcgagaccacccacccatccccatcaccgacctggcggacaac
atcgagcgcctcaaagccaacgatggcctcaagttctcccaggagtatgagtccatcgac
cctggacagcagttcacgtgggagaattcaaacctggaggtgaacaagcccaagaaccgc
tatgcgaatgtcatcgcctacgaccactctcgagtcatccttacctctatcgatggcgtc
cccgggagtgactacatcaatgccaactacatcgatggctaccgcaagcagaatgcctac
atcgccacgcagggccccctgcccgagaccatgggtgatttctggaggatggtgtgggaa
cagcgcacggccactgtggtcatgatgacacggctggaggagaagtcccgggtaaaatgt
gatcagtactggccagcccgtggcaccgagacctgtggccttattcaggtgaccctgttg
gacacagtggagctggccacatacactgtgcgcaccttcgcactccacaagagtggctcc
agtgagaagcgcgagctgcgtcagtttcagttcatggcctggccagaccatggagttcct
gagtacccaactcccatcctggccttcctacgacgggtcaaggcctgcaaccccctagac
gcagggcccatggtggtgcactgcagcgcgggcgtgggccgcaccggctgcttcatcgtg
attgatgccatgttggagcggatgaagcacgagaagacggtggacatctatggccacgtg
acctgcatgcgatcacagaggaactacatggtgcagacggaggaccagtacgtgttcatc
catgaggcgctgctggaggctgccacgtgcggccacacagaggtgcctgcccgcaacctg
tatgcccacatccagaagctgggccaagtgcctccaggggagagtgtgaccgccatggag
ctcgagttcaagttgctggccagctccaaggcccacacgtcccgcttcatcagcgccaac
ctgccctgcaacaagttcaagaaccggctggtgaacatcatgccctacgaattgacccgt
gtgtgtctgcagcccatccgtggtgtggagggctctgactacatcaatgccagcttcctg
gatggttatagacagcagaaggcctacatagctacacaggggcctctggcagagagcacc
gaggacttctggcgcatgctatgggagcacaattccaccatcatcgtcatgctgaccaag
cttcgggagatgggcagggagaaatgccaccagtactggccagcagagcgctctgctcgc
taccagtactttgttgttgacccgatggctgagtacaacatgccccagtatatcctgcgt
gagttcaaggtcacggatgcccgggatgggcagtcaaggacaatccggcagttccagttc
acagactggccagagcagggcgtgcccaagacaggcgagggattcattgacttcatcggg
caggtgcataagaccaaggagcagtttggacaggatgggcctatcacggtgcactgcagt
gctggcgtgggccgcaccggggtgttcatcactctgagcatcgtcctggagcgcatgcgc
tacgagggcgtggtcgacatgtttcagaccgtgaagaccctgcgtacacagcgtcctgcc
atggtgcagacagaggaccagtatcagctgtgctaccgtgcggccctggagtacctcggc
agctttgaccactatgcaacgtaa

DBGET integrated database retrieval system