KEGG   Homo sapiens (human): 5793Help
Entry
5793              CDS       T01001                                 

Gene name
PTPRG, HPTPG, PTPG, R-PTP-GAMMA, RPTPG
Definition
(RefSeq) protein tyrosine phosphatase, receptor type G
  KO
K16667  receptor-type tyrosine-protein phosphatase gamma [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5793 (PTPRG)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5793 (PTPRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase Carb_anhydrase fn3 DSPc Pur_ac_phosph_N Y_phosphatase3 PTPlike_phytase TMEM119
Motif
Other DBs
NCBI-GeneID: 5793
NCBI-ProteinID: NP_002832
OMIM: 176886
HGNC: 9671
Ensembl: ENSG00000144724
Vega: OTTHUMG00000158660
Pharos: P23470(Tchem)
UniProt: P23470 Q49A02
Structure
PDB: 

Jmol
Position
3p14.2
AA seq 1445 aa AA seqDB search
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
AASASKQAARPVLATTEALASPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGE
KDSEKKEKSGVTHAAEERNQTEPSPTPSSPNRTAEGGHQTIPGHEQDHTAVPTDQTGGRR
DAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKPMSRGDRFSEDSRFITVNPAE
KNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREV
PSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKD
SKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK
CDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQ
YHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQI
KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSIL
IPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGM
KGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWP
NPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVF
QVAKMINLMRPGVFTDIEQYQFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAES
MESLV
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggttactggaaccgtgttggtggattttgttcctgaaaatcaccagttccgtg
ctccattatgtcgtgtgcttccccgcgttgacagaaggctacgttggggccctgcacgag
aatagacacggcagcgcagtgcagatccgcaggcgcaaggcttcaggcgacccgtactgg
gcctactctggtgcctatggtcctgagcactgggtcacgtctagtgtcagctgtgggggc
cgtcaccagtctcctattgacattttagaccagtatgcgcgtgttggggaagaataccag
gaactgcaactcgatggcttcgacaatgagtcttctaacaaaacctggatgaaaaacaca
gggaaaacagtcgccatccttctgaaagacgactattttgtcagtggagctggtctacct
ggcagattcaaagctgagaaggtggaatttcactggggccacagcaatggctcagcgggc
tctgaacacagcatcaatggcaggaggtttcctgttgagatgcagattttcttttacaat
ccagatgactttgacagctttcaaaccgcaatttctgagaacagaataatcggagccatg
gccatattttttcaagtcagtccgagggacaattctgcactggatcctattatccacggg
ttgaagggtgtcgtacatcatgagaaggagacctttctggatcctttcgtcctccgggac
ctcctgcctgcatccctgggcagctattatcggtacacaggttccttgaccacaccaccg
tgtagcgaaatagtggagtggatagtcttccggagacccgtccccatctcttaccatcag
cttgaggctttttattccatcttcaccacggagcagcaagaccatgtcaagtcggtggag
tatctgagaaataactttcgaccacagcagcgtctgcatgacagggtggtgtccaagtcc
gccgtccgtgactcctggaaccacgacatgacagacttcttagaaaacccactggggaca
gaagcctctaaagtttgcagctctccacccatccacatgaaggtgcagcctctgaaccag
acggcactgcaggtgtcctggagccagccggagactatctaccacccacccatcatgaac
tacatgatctcctacagctggaccaagaatgaggacgagaaggagaagacgtttacaaag
gacagcgacaaagacttgaaagccaccattagccatgtctcacccgatagcctttacctg
ttccgagtccaggccgtgtgtcggaacgacatgcgcagcgactttagccagacgatgctg
tttcaagctaataccactcgaatattccaagggaccagaatagtgaaaacaggagtgccc
acagcgtctcctgcctcttcagccgacatggcccccatcagctcggggtcttctacctgg
acgtcctctggcatcccattctcatttgtttccatggcaactgggatgggcccctcctcc
agtggcagccaggccacagtggcctcggtggtcaccagcacgctgctcgccggcctgggg
ttcggcggtggtggcatctcctctttccccagcactgtgtggcccacgcgcctcccgacg
gccgcctcagccagcaagcaggcggctaggccagtcctagccaccacagaggccttggct
tctccagggcccgatggtgattcgtcaccaaccaaggacggcgagggcaccgaggaagga
gagaaggatgagaaaagcgagagtgaggatggggagcgggagcacgaggaggatggagag
aaggactccgaaaagaaggagaagagtggggtgacccacgctgccgaggagcggaatcag
acggagcccagccccacaccctcgtctcctaacaggactgccgagggagggcatcagact
atacctgggcatgagcaggatcacactgccgtccccacagaccagacgggcggaaggagg
gatgccggcccaggcctggaccccgacatggtcacctccacccaagtgccccccaccgcc
acagaggagcagtatgcagggagtgatcccaagaggcccgaaatgccatctaaaaagcct
atgtcccgcggggaccgattttctgaagacagcagatttatcactgttaatccagcggaa
aaaaacacctctggaatgataagccgccctgctccagggaggatggagtggatcatccct
ctgattgtggtatcagccttgaccttcgtgtgcctcatccttctcattgctgtgctcgtt
tactggagagggtgtaacaaaataaagtccaagggctttcccagacgtttccgtgaagtg
ccttcttctggggagagaggagagaaggggagcagaaaatgttttcagactgctcatttc
tatgtggaagacagcagttcacctcgagtggtccctaatgaaagtatccctattattcct
attccggatgacatggaagccattcctgtcaaacagtttgtcaaacacatcggtgagctc
tattctaataaccagcatgggttctctgaggattttgaggaagtccagcgctgtactgct
gatatgaacatcactgcagagcattccaatcatccagaaaacaagcacaaaaacagatac
atcaacattttagcatatgatcacagtagggtgaagttaagacctttaccaggaaaagac
tctaagcacagcgactacattaatgcaaactatgttgatggttacaacaaagcaaaagcc
tacattgccacccaaggacctttgaagtctacatttgaagatttctggaggatgatttgg
gaacaaaacactggaatcattgtgatgattacgaaccttgtggaaaaaggaagacgaaaa
tgtgatcagtattggccaacagagaacagtgaggaatatggaaacattattgtcacgctg
aagagcacaaaaatacatgcctgctacactgttcgtcgtttttcaatcagaaatacaaaa
gtgaaaaagggtcagaagggaaatcccaagggtcgtcagaatgaaagggtagtgatccag
tatcactatacacagtggcctgacatgggagttcccgagtatgcccttccagtactgact
ttcgtgaggagatcctcagcagctcggatgccagaaacgggccctgtgttggtgcactgc
agtgctggtgtgggcagaacaggcacctatattgtaatagacagcatgctgcaacagata
aaagacaaaagcacagttaacgtcctgggattcctgaagcatatcaggacacagcgtaac
tacctcgtccagactgaggagcagtacattttcatccatgatgccttgttggaagccatt
cttggaaaggagactgaagtatcttcaaatcagctgcacagctatgttaacagcatcctt
ataccaggagtaggaggaaagacacgactggaaaagcaattcaagctggtcacacagtgt
aatgcaaaatatgtggaatgtttcagtgctcagaaagagtgtaacaaagaaaagaacaga
aactcttcagttgtgccatctgagcgtgctcgagtgggtcttgcaccattgcctggaatg
aaaggaacagattacattaatgcttcttatatcatgggctattataggagcaatgaattt
attataactcagcatcctctgccacatactacgaaagatttctggcgaatgatttgggat
cataacgcacagatcattgtcatgctgccagacaaccagagcttggcagaagatgagttt
gtgtactggccaagtcgagaagaatccatgaactgtgaggcctttaccgtcacccttatc
agcaaagacagactgtgcctctctaatgaagaacaaattatcatccatgactttatcctt
gaagctacacaggatgactatgtcttagaagttcggcactttcagtgtcccaaatggcct
aacccagatgcccccataagtagtacctttgaacttatcaacgtcatcaaggaagaggcc
ttaacaagggatggtcccaccattgttcatgatgagtatggagcagtttcagcaggaatg
ttatgtgcccttaccaccctgtcccagcaactggagaatgaaaatgctgtggatgttttc
caggttgcaaaaatgatcaatcttatgaggcctggagtattcacagacattgaacaatac
cagttcatctataaagcaatgcttagcttggtcagcactaaagaaaatggaaatggtccc
atgacagtagacaaaaatggtgctgttcttattgcagatgaatcagaccctgctgagagc
atggagtccctagtgtga

DBGET integrated database retrieval system