KEGG   Homo sapiens (human): 5793Help
Entry
5793              CDS       T01001                                 

Gene name
PTPRG, HPTPG, PTPG, R-PTP-GAMMA, RPTPG
Definition
(RefSeq) protein tyrosine phosphatase, receptor type G
  KO
K16667  
receptor-type tyrosine-protein phosphatase gamma [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5793 (PTPRG)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5793 (PTPRG)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/4 subfamily
    CNTN3; contactin 3 [KO:K06761]
     5793 (PTPRG)
    CNTN4; contactin 4 [KO:K06762]
     5793 (PTPRG)
    CNTN5; contactin 5 [KO:K06763]
     5793 (PTPRG)
    CNTN6; contactin 6 [KO:K06764]
     5793 (PTPRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21-p14
AA seq 1445 aa AA seqDB search
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGRHQSPIDILDQYARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQRLHDRVVSKSAVRDSWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
AASASKQAARPVLATTEALASPGPDGDSSPTKDGEGTEEGEKDEKSESEDGEREHEEDGE
KDSEKKEKSGVTHAAEERNQTEPSPTPSSPNRTAEGGHQTIPGHEQDHTAVPTDQTGGRR
DAGPGLDPDMVTSTQVPPTATEEQYAGSDPKRPEMPSKKPMSRGDRFSEDSRFITVNPAE
KNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREV
PSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKD
SKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK
CDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKGQKGNPKGRQNERVVIQ
YHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGVGRTGTYIVIDSMLQQI
KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSIL
IPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGM
KGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWP
NPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVF
QVAKMINLMRPGVFTDIEQYQFIYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAES
MESLV
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atgcggaggttactggaaccgtgttggtggattttgttcctgaaaatcaccagttccgtg
ctccattatgtcgtgtgcttccccgcgttgacagaaggctacgttggggccctgcacgag
aatagacacggcagcgcagtgcagatccgcaggcgcaaggcttcaggcgacccgtactgg
gcctactctggtgcctatggtcctgagcactgggtcacgtctagtgtcagctgtgggggc
cgtcaccagtctcctattgacattttagaccagtatgcgcgtgttggggaagaataccag
gaactgcaactcgatggcttcgacaatgagtcttctaacaaaacctggatgaaaaacaca
gggaaaacagtcgccatccttctgaaagacgactattttgtcagtggagctggtctacct
ggcagattcaaagctgagaaggtggaatttcactggggccacagcaatggctcagcgggc
tctgaacacagcatcaatggcaggaggtttcctgttgagatgcagattttcttttacaat
ccagatgactttgacagctttcaaaccgcaatttctgagaacagaataatcggagccatg
gccatattttttcaagtcagtccgagggacaattctgcactggatcctattatccacggg
ttgaagggtgtcgtacatcatgagaaggagacctttctggatcctttcgtcctccgggac
ctcctgcctgcatccctgggcagctattatcggtacacaggttccttgaccacaccaccg
tgtagcgaaatagtggagtggatagtcttccggagacccgtccccatctcttaccatcag
cttgaggctttttattccatcttcaccacggagcagcaagaccatgtcaagtcggtggag
tatctgagaaataactttcgaccacagcagcgtctgcatgacagggtggtgtccaagtcc
gccgtccgtgactcctggaaccacgacatgacagacttcttagaaaacccactggggaca
gaagcctctaaagtttgcagctctccacccatccacatgaaggtgcagcctctgaaccag
acggcactgcaggtgtcctggagccagccggagactatctaccacccacccatcatgaac
tacatgatctcctacagctggaccaagaatgaggacgagaaggagaagacgtttacaaag
gacagcgacaaagacttgaaagccaccattagccatgtctcacccgatagcctttacctg
ttccgagtccaggccgtgtgtcggaacgacatgcgcagcgactttagccagacgatgctg
tttcaagctaataccactcgaatattccaagggaccagaatagtgaaaacaggagtgccc
acagcgtctcctgcctcttcagccgacatggcccccatcagctcggggtcttctacctgg
acgtcctctggcatcccattctcatttgtttccatggcaactgggatgggcccctcctcc
agtggcagccaggccacagtggcctcggtggtcaccagcacgctgctcgccggcctgggg
ttcggcggtggtggcatctcctctttccccagcactgtgtggcccacgcgcctcccgacg
gccgcctcagccagcaagcaggcggctaggccagtcctagccaccacagaggccttggct
tctccagggcccgatggtgattcgtcaccaaccaaggacggcgagggcaccgaggaagga
gagaaggatgagaaaagcgagagtgaggatggggagcgggagcacgaggaggatggagag
aaggactccgaaaagaaggagaagagtggggtgacccacgctgccgaggagcggaatcag
acggagcccagccccacaccctcgtctcctaacaggactgccgagggagggcatcagact
atacctgggcatgagcaggatcacactgccgtccccacagaccagacgggcggaaggagg
gatgccggcccaggcctggaccccgacatggtcacctccacccaagtgccccccaccgcc
acagaggagcagtatgcagggagtgatcccaagaggcccgaaatgccatctaaaaagcct
atgtcccgcggggaccgattttctgaagacagcagatttatcactgttaatccagcggaa
aaaaacacctctggaatgataagccgccctgctccagggaggatggagtggatcatccct
ctgattgtggtatcagccttgaccttcgtgtgcctcatccttctcattgctgtgctcgtt
tactggagagggtgtaacaaaataaagtccaagggctttcccagacgtttccgtgaagtg
ccttcttctggggagagaggagagaaggggagcagaaaatgttttcagactgctcatttc
tatgtggaagacagcagttcacctcgagtggtccctaatgaaagtatccctattattcct
attccggatgacatggaagccattcctgtcaaacagtttgtcaaacacatcggtgagctc
tattctaataaccagcatgggttctctgaggattttgaggaagtccagcgctgtactgct
gatatgaacatcactgcagagcattccaatcatccagaaaacaagcacaaaaacagatac
atcaacattttagcatatgatcacagtagggtgaagttaagacctttaccaggaaaagac
tctaagcacagcgactacattaatgcaaactatgttgatggttacaacaaagcaaaagcc
tacattgccacccaaggacctttgaagtctacatttgaagatttctggaggatgatttgg
gaacaaaacactggaatcattgtgatgattacgaaccttgtggaaaaaggaagacgaaaa
tgtgatcagtattggccaacagagaacagtgaggaatatggaaacattattgtcacgctg
aagagcacaaaaatacatgcctgctacactgttcgtcgtttttcaatcagaaatacaaaa
gtgaaaaagggtcagaagggaaatcccaagggtcgtcagaatgaaagggtagtgatccag
tatcactatacacagtggcctgacatgggagttcccgagtatgcccttccagtactgact
ttcgtgaggagatcctcagcagctcggatgccagaaacgggccctgtgttggtgcactgc
agtgctggtgtgggcagaacaggcacctatattgtaatagacagcatgctgcaacagata
aaagacaaaagcacagttaacgtcctgggattcctgaagcatatcaggacacagcgtaac
tacctcgtccagactgaggagcagtacattttcatccatgatgccttgttggaagccatt
cttggaaaggagactgaagtatcttcaaatcagctgcacagctatgttaacagcatcctt
ataccaggagtaggaggaaagacacgactggaaaagcaattcaagctggtcacacagtgt
aatgcaaaatatgtggaatgtttcagtgctcagaaagagtgtaacaaagaaaagaacaga
aactcttcagttgtgccatctgagcgtgctcgagtgggtcttgcaccattgcctggaatg
aaaggaacagattacattaatgcttcttatatcatgggctattataggagcaatgaattt
attataactcagcatcctctgccacatactacgaaagatttctggcgaatgatttgggat
cataacgcacagatcattgtcatgctgccagacaaccagagcttggcagaagatgagttt
gtgtactggccaagtcgagaagaatccatgaactgtgaggcctttaccgtcacccttatc
agcaaagacagactgtgcctctctaatgaagaacaaattatcatccatgactttatcctt
gaagctacacaggatgactatgtcttagaagttcggcactttcagtgtcccaaatggcct
aacccagatgcccccataagtagtacctttgaacttatcaacgtcatcaaggaagaggcc
ttaacaagggatggtcccaccattgttcatgatgagtatggagcagtttcagcaggaatg
ttatgtgcccttaccaccctgtcccagcaactggagaatgaaaatgctgtggatgttttc
caggttgcaaaaatgatcaatcttatgaggcctggagtattcacagacattgaacaatac
cagttcatctataaagcaatgcttagcttggtcagcactaaagaaaatggaaatggtccc
atgacagtagacaaaaatggtgctgttcttattgcagatgaatcagaccctgctgagagc
atggagtccctagtgtga

DBGET integrated database retrieval system