KEGG   Homo sapiens (human): 5797Help
Entry
5797              CDS       T01001                                 

Gene name
PTPRM, PTPRL1, R-PTP-MU, RPTPM, RPTPU, hR-PTPu
Definition
(RefSeq) protein tyrosine phosphatase, receptor type M
  KO
K05693  
receptor-type tyrosine-protein phosphatase mu [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5797 (PTPRM)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    5797 (PTPRM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5797 (PTPRM)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5797 (PTPRM)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRM; receptor-type tyrosine-protein phosphatase mu [KO:K05693]
     5797 (PTPRM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P28827(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.23
AA seq 1452 aa AA seqDB search
MRGLGTCLATLAGLLLTAAGETFSGGCLFDEPYSTCGYSQSEGDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNASGRPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNSPPGLLNVYVKV
NNGPLGNPIWNISGDPTRTWNRAELAISTFWPNFYQVIFEVITSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYC
YQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDED
LPGAVPTESIQGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQT
DNTVTVMLKPAHSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASLLNSQYY
FAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRIYFQAASRANGETKIDCVQVA
TKGAATPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSST
RQEMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDETHTMASDTSSLVQSHTYKKREPADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGF
KEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYID
GYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYK
DIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQV
KSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQT
EEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTL
RVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVT
QHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLE
EDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNG
GEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKF
CYEVALEYLNSG
NT seq 4359 nt NT seq  +upstreamnt  +downstreamnt
atgaggggacttgggacttgcctggcgactttggccggacttttgctaactgcggcgggc
gagacgttctcaggtggctgcctctttgatgagccgtatagcacatgtggatatagtcaa
tctgaaggtgatgacttcaattgggagcaagtgaacaccttgactaaaccgacttctgat
ccatggatgccatcaggttctttcatgctggtgaatgcctctgggagacctgaggggcag
agagcccacctgctcttaccccaacttaaagaaaatgacacccactgcatcgattttcac
tattttgtgtccagcaagagtaattctcctccggggttactcaatgtctacgtgaaggtc
aataacgggccactggggaatcctatctggaatatatctggagacccaacacgtacatgg
aacagggcagaactggccattagtactttctggcctaacttttatcaggtgatttttgaa
gtgataacttctggacatcaaggctatctcgctatcgatgaggtgaaggtgttaggacat
ccatgtaccaggactcctcacttcctgcggattcagaatgtggaagttaatgctggccag
tttgctaccttccagtgcagtgccatcggcaggaccgtggcaggagacaggctctggtta
cagggcattgatgtgcgagatgctcctctgaaggaaatcaaggtgaccagctcccgacgc
ttcattgcttcatttaatgttgtgaataccaccaaacgagatgctggaaagtaccgctgc
atgattcgcactgaaggaggtgttggaatatcaaactatgcagagttggtagttaaagaa
ccacccgttcctattgccccacctcagctcgcctctgtaggagccacctacctgtggata
cagctcaacgccaactccatcaatggggatgggcccattgtggcccgagaggtggagtac
tgcacggccagtgggagctggaatgaccggcagccagtcgattccacgagctataaaatt
ggacaccttgacccagatacagaatatgagattagtgtgctcctgaccaggccaggggag
ggtggcactggctctcctggtccagctctcaggacaagaacaaagtgtgctgatcccatg
cgaggcccaagaaaactagaagtagtggaggtcaaatctcggcaaatcactatccgctgg
gagccatttggatataatgtaactcgttgccacagttataatctcactgtccactactgt
taccaagttggaggacaagaacaagtgcgagaagaagtaagctgggatacagaaaactca
caccctcaacacacgatcactaacctgtcaccatacaccaatgtcagtgtgaaactgatc
ctcatgaacccagagggccggaaggaaagccaagaactcatagtgcagacagatgaagac
ctcccaggtgctgttcccactgaatccatacaaggaagtacctttgaagagaagatattt
cttcagtggagagaaccaactcaaacatatggtgtaatcactttatatgagatcacctac
aaagcagtcagttcctttgacccagaaatagatttatccaatcagagtggaagagtttca
aagctgggaaatgaaacccattttctgttttttggactgtatccggggaccacatactcc
tttaccatccgagctagcacagctaagggttttgggcctccagcaacaaaccagttcacc
accaaaatatcagcaccctctatgccagcttatgaacttgagacacctttgaatcaaact
gacaataccgtgacagtcatgctgaaacctgcccacagcagaggagcacctgtcagtgtc
tatcaaatagttgttgaggaagaacgtcctcgaagaactaaaaagacgacagaaatctta
aagtgctacccagtgccaattcacttccagaatgcttctctgctgaactcacagtactac
tttgctgcagaatttcctgcagacagcctccaagctgcgcagccttttacaattggtgat
aataagacatataatggatactggaacactccccttctcccctataaaagctacagaatt
tatttccaagctgctagtagagccaatggggaaaccaaaatagactgtgtccaagtggcc
acaaaaggagctgccactccgaaaccagtcccagaacccgagaaacagacagaccataca
gttaaaattgctggagtcatcgcgggcatcttgctgttcgtgattatatttcttggagtt
gtgttggtaatgaagaaaaggaaactggccaagaagcggaaagagaccatgagcagcacc
cgacaggagatgactgtgatggtgaactcaatggacaagagctatgctgagcagggcaca
aactgcgacgaggctttctcattcatggacacgcacaatctgaatgggagatctgtgtct
tcaccatcgtccttcacaatgaaaacaaatacactgagcacatcggtgcctaattcctat
tacccagatgaaacccacacaatggccagcgataccagcagcctggtgcagtcccatact
tacaagaagcgagagccggccgacgtgccctatcagactgggcagctccaccccgccatc
cgggtggcagacctccttcagcacatcacacagatgaagtgtgcggagggctacggcttc
aaggaggaatacgagagcttctttgaagggcagtctgcaccatgggactcggctaagaaa
gatgagaacagaatgaagaacagatacgggaatatcattgcatacgatcattcccgagtg
aggctgcagacaatagaaggagacacaaactcagactatatcaatggcaattatatcgat
ggttatcatcgacccaatcattacattgctacccaagggccaatgcaggaaaccatctat
gacttctggaggatggtgtggcacgaaaacactgcaagtatcatcatggtgaccaatctt
gtggaagtgggaagggtcaaatgctgcaaatactggccagatgacacagagatatataaa
gacattaaagttaccctaatagaaacagaactactggcagaatatgtgataagaacattt
gctgttgaaaagagaggtgtgcatgaaatccgagagatcagacagtttcacttcactggc
tggccggatcatggggtcccctaccatgccaccggcctgctgggattcgtgcggcaagtc
aagtccaagagcccgcccagtgcaggcccactggtggtgcactgcagtgctggtgcaggg
aggactggctgtttcatcgtcattgatatcatgttggacatggccgaaagggaaggggtc
gtagacatctacaactgcgtcagggagctgcggtcacggagggtgaacatggtgcaaaca
gaggagcagtatgtgtttatccacgatgcgatcctggaagcctgtctttgtggggacacc
tctgtgcctgcttcccaagttaggtctctgtattatgacatgaacaaactggatccacag
acaaactcaagccagattaaagaggaattccggacgctaaacatggtgacaccaacgctg
cgagtagaggactgcagcatcgcactgttgccccggaaccatgagaaaaaccggtgcatg
gacatcctgcccccagaccgctgcctgcccttcctcatcaccatcgatggggagagcagc
aactacatcaatgctgccctcatggacagctataaacagccttcagcttttatagtcacc
cagcatcctttgccaaacacagtgaaagacttttggagactggtcctggattatcactgc
acatccgtagttatgctaaatgatgtggatcctgcccagttgtgtccacagtactggcca
gaaaacggagtacacagacacggccccatccaggtggaatttgtctctgctgacctggaa
gaggacatcatcagcaggatattccgcatttacaatgccgccagaccccaagatggatat
cggatggtgcagcaattccagttcctgggctggccgatgtacagggacacaccagtgtct
aagcgctccttcttgaagctcattcgccaggtggacaagtggcaagaggagtacaatggc
ggggaaggccgcacggttgtgcactgcttgaacgggggaggccgcagtgggacgttctgc
gccatcagcatcgtatgtgagatgctccggcaccagagaaccgtggatgtctttcacgct
gtgaagacactgaggaacaacaagcccaacatggtcgacctcctggatcagtacaagttc
tgctacgaggtggccctggaatacttgaattctggctga

DBGET integrated database retrieval system