KEGG   Homo sapiens (human): 5799Help
Entry
5799              CDS       T01001                                 

Gene name
PTPRN2, IA-2beta, IAR, ICAAR, PTPRP, R-PTP-N2
Definition
protein tyrosine phosphatase, receptor type, N polypeptide 2 (EC:3.1.3.48)
Orthology
K07817  
receptor-type tyrosine-protein phosphatase N [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Type I diabetes mellitus
Class
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:hsa04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36
AA seq 1015 aa AA seqDB search
MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGR
CQKVPAMDFYRYEVSPVALQRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRP
EASSPARPSKHSVGSERRYSREGGAALANALRRHLPFLEALSQAPASDVLARTHTAQDRP
PAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRH
HLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSS
TGDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELMAGLMQGVDHGVARGSPGRAALGES
GEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARP
LDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGP
SKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVP
SSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKL
KFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYCLRHSSQHRLKEKLSGLGGDPGA
DATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQ
SNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVL
TYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCV
VIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNET
RTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDM
VLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atggggccgccgctcccgctgctgctgctgctactgctgctgctgccgccacgcgtcctg
cctgccgccccttcgtccgtcccccgcggccggcagctcccggggcgtctgggctgcctg
ctcgaggagggcctctgcggagcgtccgaggcctgtgtgaacgatggagtgtttggaagg
tgccagaaggttccggcaatggacttttaccgctacgaggtgtcgcccgtggccctgcag
cgcctgcgcgtggcgttgcagaagctttccggcacaggtttcacgtggcaggatgactat
actcagtatgtgatggaccaggaacttgcagacctcccgaaaacctacctgaggcgtcct
gaagcatccagcccagccaggccctcaaaacacagcgttggcagcgagaggaggtacagt
cgggagggcggtgctgccctggccaacgccctccgacgccacctgcccttcctggaggcc
ctgtcccaggccccagcctcagacgtgctcgccaggacccatacggcgcaggacagaccc
cccgctgagggtgatgaccgcttctccgagagcatcctgacctatgtggcccacacgtct
gcgctgacctaccctcccgggtcccggacccagctccgcgaggacctcctgccgcggacc
ctcggccagctccagccagatgagctcagccctaaggtggacagtggtgtggacagacac
catctgatggcggccctcagtgcctatgctgcccagaggcccccagctccccccggggag
ggcagcctggagccacagtaccttctgcgtgcaccctcaagaatgcccaggcctttgctg
gcaccagccgccccccagaagtggccttcacctctgggagattccgaagacccctccagc
acaggcgatggagcacggattcataccctcctgaaggacctgcagaggcagccggctgag
gtgaggggcctgagtggcctggagctggacggcatggctgagctgatggctggcctgatg
caaggcgtggaccatggagtagctcgaggcagccctgggagagcggccctgggagagtct
ggagaacaggcggatggccccaaggccaccctccgtggagacagctttccagatgacgga
gtgcaggacgacgatgatagactttaccaagaggtccatcgtctgagtgccacactcggg
ggcctcctgcaggaccacgggtctcgactcttacctggagccctcccctttgcaaggccc
ctcgacatggagaggaagaagtccgagcaccctgagtcttccctgtcttcagaagaggag
actgccggagtggagaacgtcaagagccagacgtattccaaagatctgctggggcagcag
ccgcattcggagcccggggccgctgcgtttggggagctccaaaaccagatgcctgggccc
tcgaaggaggagcagagccttccagcgggtgctcaggaggccctcagcgacggcctgcaa
ttggaggtccagccttccgaggaagaggcgcggggctacatcgtgacagacagagacccc
ctgcgccccgaggaaggaaggcggctggtggaggacgtcgcccgcctcctgcaggtgccc
agcagtgcgttcgctgacgtggaggttctcggaccagcagtgaccttcaaagtgagcgcc
aatgtccaaaacgtgaccactgaggatgtggagaaggccacagttgacaacaaagacaaa
ctggaggaaacctctggactgaaaattcttcaaaccggagtcgggtcgaaaagcaaactc
aagttcctgcctcctcaggcggagcaagaagactccaccaagttcatcgcgctcaccctg
gtctccctcgcctgcatcctgggcgtcctcctggcctctggcctcatctactgcctccgc
catagctctcagcacaggctgaaggagaagctctcgggactagggggcgacccaggtgca
gatgccactgccgcctaccaggagctgtgccgccagcgtatggccacgcggccaccagac
cgacctgagggcccgcacacgtcacgcatcagcagcgtctcatcccagttcagcgacggg
ccgatccccagcccctccgcacgcagcagcgcctcatcctggtccgaggagcctgtgcag
tccaacatggacatctccaccggccacatgatcctgtcctacatggaggaccacctgaag
aacaagaaccggctggagaaggagtgggaagcgctgtgcgcctaccaggcggagcccaac
agctcgttcgtggcccagagggaggagaacgtgcccaagaaccgctccctggccgtgctg
acctatgaccactcccgggtcctgctgaaggcggagaacagccacagccactcagactac
atcaacgctagccccatcatggatcacgacccgaggaaccccgcgtacatcgccacccag
ggaccgctgcccgccaccgtggctgacttttggcagatggtgtgggagagcggctgcgtg
gtgatcgtcatgctgacacccctcgcggagaacggcgtccggcagtgctaccactactgg
ccggatgaaggctccaatctctaccacatctatgaggtgaacctggtctccgagcacatc
tggtgtgaggacttcctggtgaggagcttctatctgaagaacctgcagaccaacgagacg
cgcaccgtgacgcagttccacttcctgagttggtatgaccgaggagtcccttcctcctca
aggtccctcctggacttccgcagaaaagtaaacaagtgctacaggggccgttcttgtcca
ataattgttcattgcagtgacggtgcaggccggagcggcacctacgtcctgatcgacatg
gttctcaacaagatggccaaaggtgctaaagagattgatatcgcagcgaccctggagcac
ttgagggaccagagacccggcatggtccagacgaaggagcagtttgagttcgcgctgaca
gccgtggctgaggaggtgaacgccatcctcaaggcccttccccagtga

DBGET integrated database retrieval system