KEGG   Homo sapiens (human): 580Help
Entry
580               CDS       T01001                                 

Gene name
BARD1
Definition
(RefSeq) BRCA1 associated RING domain 1
  KO
K10683  
BRCA1-associated RING domain protein 1
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     580 (BARD1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    580 (BARD1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     580 (BARD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q35
AA seq 777 aa AA seqDB search
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREP
VCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNEL
SDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSY
EFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLV
SFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTP
EKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLP
ECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELL
LQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMK
SLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEF
DSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRS
RLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV
AYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgccggataatcggcagccgaggaaccggcagccgaggatccgctccgggaacgagcct
cgttccgcgcccgccatggaaccggatggtcgcggtgcctgggcccacagtcgcgccgcg
ctcgaccgcctggagaagctgctgcgctgctcgcgttgtactaacattctgagagagcct
gtgtgtttaggaggatgtgagcacatcttctgtagtaattgtgtaagtgactgcattgga
actggatgtccagtgtgttacaccccggcctggatacaagacttgaagataaatagacaa
ctggacagcatgattcaactttgtagtaagcttcgaaatttgctacatgacaatgagctg
tcagatttgaaagaagataaacctaggaaaagtttgtttaatgatgcaggaaacaagaag
aattcaattaaaatgtggtttagccctcgaagtaagaaagtcagatatgttgtgagtaaa
gcttcagtgcaaacccagcctgcaataaaaaaagatgcaagtgctcagcaagactcatat
gaatttgtttccccaagtcctcctgcagatgtttctgagagggctaaaaaggcttctgca
agatctggaaaaaagcaaaaaaagaaaactttagctgaaatcaaccaaaaatggaattta
gaggcagaaaaagaagatggtgaatttgactccaaagaggaatctaagcaaaagctggta
tccttctgtagccaaccatctgttatctccagtcctcagataaatggtgaaatagactta
ctagcaagtggctccttgacagaatctgaatgttttggaagtttaactgaagtctcttta
ccattggctgagcaaatagagtctccagacactaagagcaggaatgaagtagtgactcct
gagaaggtctgcaaaaattatcttacatctaagaaatctttgccattagaaaataatgga
aaacgtggccatcacaatagactttccagtcccatttctaagagatgtagaaccagcatt
ctgagcaccagtggagattttgttaagcaaacggtgccctcagaaaatataccattgcct
gaatgttcttcaccaccttcatgcaaacgtaaagttggtggtacatcagggaggaaaaac
agtaacatgtccgatgaattcattagtctttcaccaggtacaccaccttctacattaagt
agttcaagttacaggcgagtgatgtctagtccctcagcaatgaagctgttgcccaatatg
gctgtgaaaagaaatcatagaggagagactttgctccatattgcttctattaagggcgac
ataccttctgttgaataccttttacaaaatggaagtgatccaaatgttaaagaccatgct
ggatggacaccattgcatgaagcttgcaatcatgggcacctgaaggtagtggaattattg
ctccagcataaggcattggtgaacaccaccgggtatcaaaatgactcaccacttcacgat
gcagccaagaatgggcatgtggatatagtcaagctgttactttcctatggagcctccaga
aatgctgttaatatatttggtctgcggcctgtcgattatacagatgatgaaagtatgaaa
tcgctattgctgctaccagagaagaatgaatcatcctcagctagccactgctcagtaatg
aacactgggcagcgtagggatggacctcttgtacttataggcagtgggctgtcttcagaa
caacagaaaatgctcagtgagcttgcagtaattcttaaggctaaaaaatatactgagttt
gacagtacagtaactcatgttgttgttcctggtgatgcagttcaaagtaccttgaagtgt
atgcttgggattctcaatggatgctggattctaaaatttgaatgggtaaaagcatgtcta
cgaagaaaagtatgtgaacaggaagaaaagtatgaaattcctgaaggtccacgcagaagc
aggctcaacagagaacagctgttgccaaagctgtttgatggatgctacttctatttgtgg
ggaaccttcaaacaccatccaaaggacaaccttattaagctcgtcactgcaggtgggggc
cagatcctcagtagaaagcccaagccagacagtgacgtgactcagaccatcaatacagtc
gcataccatgcgagacccgattctgatcagcgcttctgcacacagtatatcatctatgaa
gatttgtgtaattatcacccagagagggttcggcagggcaaagtctggaaggctccttcg
agctggtttatagactgtgtgatgtcctttgagttgcttcctcttgacagctga

DBGET integrated database retrieval system