KEGG   Homo sapiens (human): 5801Help
Entry
5801              CDS       T01001                                 

Gene name
PTPRR, EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Definition
(RefSeq) protein tyrosine phosphatase, receptor type R
  KO
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5801 (PTPRR)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5801 (PTPRR)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5801 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q15
AA seq 657 aa AA seqDB search
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQK
IYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcggagagcagtctgcttccctgcgctgtgcctgctccttaatcttcacgctgcaggg
tgcttttcaggaaacaatgatcattttttggcaattaatcagaagaagagtgggaagccg
gtattcatttataagcattcacaagacattgagaagagcctggatatagccccacaaaaa
atctacagacatagctaccattcctcttccgaagctcaagtaagcaaacgccaccagatt
gtcaattcagcatttcctagacccgcatatgacccgtctctcaatctgctggccatggat
ggtcaagatcttgaagtggaaaatctcccaatcccagcagcaaatgtaattgtggtgaca
ctgcaaatggatgtaaacaagctgaacataaccttgcttcggatcttccgccaaggagtg
gctgcagctttaggactcttaccccagcaagtgcacatcaatcgcctcattggaaagaag
aacagtattgaactgtttgtgtctcccataaaccgaaaaacaggaatttctgatgctctg
ccctctgaggaagttcttcgttcacttaatatcaatgttttgcatcaaagtttatcccag
tttggaattacagaagtctctcctgagaaaaatgttttacaagggcagcatgaagcggac
aaaatctggagcaaagaaggattttatgctgttgtcatttttctcagcatctttgttatt
atagtaacgtgtttgatgattctttacagattaaaagaaagatttcagctttccttaaga
caagacaaagagaaaaaccaggagatccacctatcgcccatcacattacagccagcactg
tccgaggcaaagacagtccacagcatggtccaacctgagcaggccccaaaggtactgaat
gttgtcgtggaccctcaaggccgaggtgctcctgagatcaaagctaccaccgctacctct
gtttgcccttctcctttcaaaatgaagcccataggacttcaagagagaagagggtccaac
gtatctcttacattggacatgagtagcttggggaacattgaaccctttgtgtctatacca
acaccacgggagaaggtagcaatggagtatctgcagtcagccagccgaattctcacaagg
tctcagctgagggacgtcgtggcaagttcacatttactccaaagtgaattcatggaaata
ccaatgaactttgtggatcccaaagaaattgatattccgcgtcatggaactaaaaatcgc
tataagaccattttaccaaatcccctcagcagagtgtgtttaagaccaaaaaatgtaacc
gattcattgagcacctacattaatgctaattatattaggggctacagtggcaaggagaaa
gccttcattgccacgcagggccccatgatcaacaccgtggatgatttctggcagatggtt
tggcaggaagacagccctgtgattgttatgatcacaaaactcaaagaaaaaaatgagaaa
tgtgtgctatactggccggaaaagagagggatatatggaaaagttgaggttctggttatc
agtgtaaatgaatgtgataactacaccattcgaaaccttgtcttaaagcaaggaagccac
acccaacatgtgaagcattactggtacacctcatggcctgatcacaagactccagacagt
gcccagcccctcctacagctcatgctggatgtagaagaagacagacttgcttcccagggc
cgagggcctgtggttgtccactgcagtgcaggaataggtagaacagggtgttttattgct
acatccattggctgtcaacagctgaaagaagaaggagttgtggatgcactaagcattgtc
tgccagcttcgtatggatagaggtggaatggtgcaaaccagtgagcagtatgaatttgtg
caccatgctctgtgcctgtatgagagcagactttcagcagagactgtccagtga

DBGET integrated database retrieval system