KEGG   Homo sapiens (human): 5803Help
Entry
5803              CDS       T01001                                 

Gene name
PTPRZ1, HPTPZ, HPTPzeta, PTP-ZETA, PTP18, PTPRZ, PTPZ, R-PTP-zeta-2, RPTPB, RPTPbeta, phosphacan
Definition
(RefSeq) protein tyrosine phosphatase, receptor type Z1
  KO
K08114  
receptor-type tyrosine-protein phosphatase zeta [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5803 (PTPRZ1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5803 (PTPRZ1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5803 (PTPRZ1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    NRCAM; neuronal cell adhesion molecule [KO:K06756]
     5803 (PTPRZ1)
   6/4 subfamily
    CNTN1; contactin 1 [KO:K06759]
     5803 (PTPRZ1)
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     5803 (PTPRZ1)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   5803 (PTPRZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P23471(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7q31.32
AA seq 2315 aa AA seqDB search
MRILKRFLACIQLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
QSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMV
FKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALS
ILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPC
TDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLDGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPE
LIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEPQISTTTHYNRIGTKYNEAKTN
RSPTRGSEFSGKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLND
GSKTVLRSPHMNLSGTAESLNTVSITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFIS
ENISQGYIFSSENPETITYDVLIPESARNASEDSTSSGSEESLKDPSMEGNVWFPSSTDI
TAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSAGPVMSQGPSVTDLEMPHYSTFAYFP
TEVTPHAFTPSSRQQDLVSTVNVVYSQTTQPVYNGETPLQPSYSSEVFPLVTPLLLDNQI
LNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ
ILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLY
KTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQG
SLFSGPSHIPIPKSSLITPTASLLQPTHALSGDGEWSGASSDSEFLLPDTDGLTALNISS
PVSVAEFTYTTSVFGDDNKALSKSEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK
LNASLQETSVSISSTKGMFPGSLAHTTTKVFDHEISQVPENNFSVQPTHTVSQASGDTSL
KPVLSANSEPASSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASDVDTLLKTVLP
AVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL
TISYASEKYEPVLLKSESSHQVVPSLYSNDELFQTANLEINQAHPPKGRHVFATPVLSID
EPLNTLINKLIHSDEILTSTKSSVTGKVFAGIPTVASDTFVSTDHSVPIGNGHVAITAVS
PHRDGSVTSTKLLFPSKATSELSHSAKSDAGLVGGGEDGDTDDDGDDDDDDRGSDGLSIH
KCMSCSSYRESQEKVMNDSDTHENSLMDQNNPISYSLSENSEEDNRVTSVSSDSQTGMDR
SPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSDSLN
ENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTSSVTSENSEVFHVSEAEASNSS
HESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPR
VISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDLGI
TADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAA
QGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQ
VLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAY
AKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEE
QYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDY
SAALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLL
HTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCLS
NEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMI
VHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVIL
SLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
NT seq 6948 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcctaaagcgtttcctcgcttgcattcagctcctctgtgtttgccgcctggat
tgggctaatggatactacagacaacagagaaaacttgttgaagagattggctggtcctat
acaggagcactgaatcaaaaaaattggggaaagaaatatccaacatgtaatagcccaaaa
caatctcctatcaatattgatgaagatcttacacaagtaaatgtgaatcttaagaaactt
aaatttcagggttgggataaaacatcattggaaaacacattcattcataacactgggaaa
acagtggaaattaatctcactaatgactaccgtgtcagcggaggagtttcagaaatggtg
tttaaagcaagcaagataacttttcactggggaaaatgcaatatgtcatctgatggatca
gagcatagtttagaaggacaaaaatttccacttgagatgcaaatctactgctttgatgcg
gaccgattttcaagttttgaggaagcagtcaaaggaaaagggaagttaagagctttatcc
attttgtttgaggttgggacagaagaaaatttggatttcaaagcgattattgatggagtc
gaaagtgttagtcgttttgggaagcaggctgctttagatccattcatactgttgaacctt
ctgccaaactcaactgacaagtattacatttacaatggctcattgacatctcctccctgc
acagacacagttgactggattgtttttaaagatacagttagcatctctgaaagccagttg
gctgttttttgtgaagttcttacaatgcaacaatctggttatgtcatgctgatggactac
ttacaaaacaattttcgagagcaacagtacaagttctctagacaggtgttttcctcatac
actggaaaggaagagattcatgaagcagtttgtagttcagaaccagaaaatgttcaggct
gacccagagaattataccagccttcttgttacatgggaaagacctcgagtcgtttatgat
accatgattgagaagtttgcagttttgtaccagcagttggatggagaggaccaaaccaag
catgaatttttgacagatggctatcaagacttgggtgctattctcaataatttgctaccc
aatatgagttatgttcttcagatagtagccatatgcactaatggcttatatggaaaatac
agcgaccaactgattgtcgacatgcctactgataatcctgaacttgatcttttccctgaa
ttaattggaactgaagaaataatcaaggaggaggaagagggaaaagacattgaagaaggc
gctattgtgaatcctggtagagacagtgctacaaaccaaatcaggaaaaaggaaccccag
atttctaccacaacacactacaatcgcatagggacgaaatacaatgaagccaagactaac
cgatccccaacaagaggaagtgaattctctggaaagggtgatgttcccaatacatcttta
aattccacttcccaaccagtcactaaattagccacagaaaaagatatttccttgacttct
cagactgtgactgaactgccacctcacactgtggaaggtacttcagcctctttaaatgat
ggctctaaaactgttcttagatctccacatatgaacttgtcggggactgcagaatcctta
aatacagtttctataacagaatatgaggaggagagtttattgaccagtttcaagcttgat
actggagctgaagattcttcaggctccagtcccgcaacttctgctatcccattcatctct
gagaacatatcccaagggtatatattttcctccgaaaacccagagacaataacatatgat
gtccttataccagaatctgctagaaatgcttccgaagattcaacttcatcaggttcagaa
gaatcactaaaggatccttctatggagggaaatgtgtggtttcctagctctacagacata
acagcacagcccgatgttggatcaggcagagagagctttctccagactaattacactgag
atacgtgttgatgaatctgagaagacaaccaagtccttttctgcaggcccagtgatgtca
cagggtccctcagttacagatctggaaatgccacattattctacctttgcctacttccca
actgaggtaacacctcatgcttttaccccatcctccagacaacaggatttggtctccacg
gtcaacgtggtatactcgcagacaacccaaccggtatacaatggtgagacacctcttcaa
ccttcctacagtagtgaagtctttcctctagtcacccctttgttgcttgacaatcagatc
ctcaacactacccctgctgcttcaagtagtgattcggccttgcatgctacgcctgtattt
cccagtgtcgatgtgtcatttgaatccatcctgtcttcctatgatggtgcacctttgctt
ccattttcctctgcttccttcagtagtgaattgtttcgccatctgcatacagtttctcaa
atccttccacaagttacttcagctaccgagagtgataaggtgcccttgcatgcttctctg
ccagtggctgggggtgatttgctattagagcccagccttgctcagtattctgatgtgctg
tccactactcatgctgcttcagagacgctggaatttggtagtgaatctggtgttctttat
aaaacgcttatgttttctcaagttgaaccacccagcagtgatgccatgatgcatgcacgt
tcttcagggcctgaaccttcttatgccttgtctgataatgagggctcccaacacatcttc
actgtttcttacagttctgcaatacctgtgcatgattctgtgggtgtaacttatcagggt
tccttatttagcggccctagccatataccaatacctaagtcttcgttaataaccccaact
gcatcattactgcagcctactcatgccctctctggtgatggggaatggtctggagcctct
tctgatagtgaatttcttttacctgacacagatgggctgacagcccttaacatttcttca
cctgtttctgtagctgaatttacatatacaacatctgtgtttggtgatgataataaggcg
ctttctaaaagtgaaataatatatggaaatgagactgaactgcaaattccttctttcaat
gagatggtttacccttctgaaagcacagtcatgcccaacatgtatgataatgtaaataag
ttgaatgcgtctttacaagaaacctctgtttccatttctagcaccaagggcatgtttcca
gggtcccttgctcataccaccactaaggtttttgatcatgagattagtcaagttccagaa
aataacttttcagttcaacctacacatactgtctctcaagcatctggtgacacttcgctt
aaacctgtgcttagtgcaaactcagagccagcatcctctgaccctgcttctagtgaaatg
ttatctccttcaactcagctcttattttatgagacctcagcttcttttagtactgaagta
ttgctacaaccttcctttcaggcttctgatgttgacaccttgcttaaaactgttcttcca
gctgtgcccagtgatccaatattggttgaaacccccaaagttgataaaattagttctaca
atgttgcatctcattgtatcaaattctgcttcaagtgaaaacatgctgcactctacatct
gtaccagtttttgatgtgtcgcctacttctcatatgcactctgcttcacttcaaggtttg
accatttcctatgcaagtgagaaatatgaaccagttttgttaaaaagtgaaagttcccac
caagtggtaccttctttgtacagtaatgatgagttgttccaaacggccaatttggagatt
aaccaggcccatcccccaaaaggaaggcatgtatttgctacacctgttttatcaattgat
gaaccattaaatacactaataaataagcttatacattccgatgaaattttaacctccacc
aaaagttctgttactggtaaggtatttgctggtattccaacagttgcttctgatacattt
gtatctactgatcattctgttcctataggaaatgggcatgttgccattacagctgtttct
ccccacagagatggttctgtaacctcaacaaagttgctgtttccttctaaggcaacttct
gagctgagtcatagtgccaaatctgatgccggtttagtgggtggtggtgaagatggtgac
actgatgatgatggtgatgatgatgatgatgacagaggtagtgatggcttatccattcat
aagtgtatgtcatgctcatcctatagagaatcacaggaaaaggtaatgaatgattcagac
acccacgaaaacagtcttatggatcagaataatccaatctcatactcactatctgagaat
tctgaagaagataatagagtcacaagtgtatcctcagacagtcaaactggtatggacaga
agtcctggtaaatcaccatcagcaaatgggctatcccaaaagcacaatgatggaaaagag
gaaaatgacattcagactggtagtgctctgcttcctctcagccctgaatctaaagcatgg
gcagttctgacaagtgatgaagaaagtggatcagggcaaggtacctcagatagccttaat
gagaatgagacttccacagatttcagttttgcagacactaatgaaaaagatgctgatggg
atcctggcagcaggtgactcagaaataactcctggattcccacagtccccaacatcatct
gttactagcgagaactcagaagtgttccacgtttcagaggcagaggccagtaatagtagc
catgagtctcgtattggtctagctgaggggttggaatccgagaagaaggcagttataccc
cttgtgatcgtgtcagccctgacttttatctgtctagtggttcttgtgggtattctcatc
tactggaggaaatgcttccagactgcacacttttacttagaggacagtacatcccctaga
gttatatccacacctccaacacctatctttccaatttcagatgatgtcggagcaattcca
ataaagcactttccaaagcatgttgcagatttacatgcaagtagtgggtttactgaagaa
tttgagacactgaaagagttttaccaggaagtgcagagctgtactgttgacttaggtatt
acagcagacagctccaaccacccagacaacaagcacaagaatcgatacataaatatcgtt
gcctatgatcatagcagggttaagctagcacagcttgctgaaaaggatggcaaactgact
gattatatcaatgccaattatgttgatggctacaacagaccaaaagcttatattgctgcc
caaggcccactgaaatccacagctgaagatttctggagaatgatatgggaacataatgtg
gaagttattgtcatgataacaaacctcgtggagaaaggaaggagaaaatgtgatcagtac
tggcctgccgatgggagtgaggagtacgggaactttctggtcactcagaagagtgtgcaa
gtgcttgcctattatactgtgaggaattttactctaagaaacacaaaaataaaaaagggc
tcccagaaaggaagacccagtggacgtgtggtcacacagtatcactacacgcagtggcct
gacatgggagtaccagagtactccctgccagtgctgacctttgtgagaaaggcagcctat
gccaagcgccatgcagtggggcctgttgtcgtccactgcagtgctggagttggaagaaca
ggcacatatattgtgctagacagtatgttgcagcagattcaacacgaaggaactgtcaac
atatttggcttcttaaaacacatccgttcacaaagaaattatttggtacaaactgaggag
caatatgtcttcattcatgatacactggttgaggccatacttagtaaagaaactgaggtg
ctggacagtcatattcatgcctatgttaatgcactcctcattcctggaccagcaggcaaa
acaaagctagagaaacaattccagctcctgagccagtcaaatatacagcagagtgactat
tctgcagccctaaagcaatgcaacagggaaaagaatcgaacttcttctatcatccctgtg
gaaagatcaagggttggcatttcatccctgagtggagaaggcacagactacatcaatgcc
tcctatatcatgggctattaccagagcaatgaattcatcattacccagcaccctctcctt
cataccatcaaggatttctggaggatgatatgggaccataatgcccaactggtggttatg
attcctgatggccaaaacatggcagaagatgaatttgtttactggccaaataaagatgag
cctataaattgtgagagctttaaggtcactcttatggctgaagaacacaaatgtctatct
aatgaggaaaaacttataattcaggactttatcttagaagctacacaggatgattatgta
cttgaagtgaggcactttcagtgtcctaaatggccaaatccagatagccccattagtaaa
acttttgaacttataagtgttataaaagaagaagctgccaatagggatgggcctatgatt
gttcatgatgagcatggaggagtgacggcaggaactttctgtgctctgacaacccttatg
caccaactagaaaaagaaaattccgtggatgtttaccaggtagccaagatgatcaatctg
atgaggccaggagtctttgctgacattgagcagtatcagtttctctacaaagtgatcctc
agccttgtgagcacaaggcaggaagagaatccatccacctctctggacagtaatggtgca
gcattgcctgatggaaatatagctgagagcttagagtctttagtttaa

DBGET integrated database retrieval system