KEGG   Homo sapiens (human): 5817Help
Entry
5817              CDS       T01001                                 

Gene name
PVR, CD155, HVED, NECL5, Necl-5, PVS, TAGE4
Definition
(RefSeq) poliovirus receptor
  KO
K06539  
poliovirus receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5817 (PVR)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    TIGIT; T-cell immunoreceptor with Ig and ITIM domains [KO:K16350]
     5817 (PVR)
   Others
    CD226, DNAM1; CD226 antigen [KO:K06567]
     5817 (PVR)
  Others
   PVRL3; poliovirus receptor-related 3 [KO:K06592]
    5817 (PVR)
 6. Sialomucin Family
  CD96; CD96 antigen [KO:K06517]
   5817 (PVR)
Cellular antigens [BR:hsa04090]
 Proteins
  5817 (PVR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P15151(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.31
AA seq 417 aa AA seqDB search
MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTH
VSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGN
YTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWH
SDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTV
YYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNAIIFLVLGILVFLILLG
IGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcccgagccatggccgccgcgtggccgctgctgctggtggcgctactggtgctgtcc
tggccacccccaggaaccggggacgtcgtcgtgcaggcgcccacccaggtgcccggcttc
ttgggcgactccgtgacgctgccctgctacctacaggtgcccaacatggaggtgacgcat
gtgtcacagctgacttgggcgcggcatggtgaatctggcagcatggccgtcttccaccaa
acgcagggccccagctattcggagtccaaacggctggaattcgtggcagccagactgggc
gcggagctgcggaatgcctcgctgaggatgttcgggttgcgcgtagaggatgaaggcaac
tacacctgcctgttcgtcacgttcccgcagggcagcaggagcgtggatatctggctccga
gtgcttgccaagccccagaacacagctgaggttcagaaggtccagctcactggagagcca
gtgcccatggcccgctgcgtctccacagggggtcgcccgccagcccaaatcacctggcac
tcagacctgggcgggatgcccaatacgagccaggtgccagggttcctgtctggcacagtc
actgtcaccagcctctggatattggtgccctcaagccaggtggacggcaagaatgtgacc
tgcaaggtggagcacgagagctttgagaagcctcagctgctgactgtgaacctcaccgtg
tactaccccccagaggtatccatctctggctatgataacaactggtaccttggccagaat
gaggccaccctgacctgcgatgctcgcagcaacccagagcccacaggctataattggagc
acgaccatgggtcccctgccaccctttgctgtggcccagggcgcccagctcctgatccgt
cctgtggacaaaccaatcaacacaactttaatctgcaacgtcaccaatgccctaggagct
cgccaggcagaactgaccgtccaggtcaaagagggacctcccagtgagcactcaggcatg
tcccgtaacgccatcatcttcctggttctgggaatcctggtttttctgatcctgctgggg
atcgggatttatttctattggtccaaatgttcccgtgaggtcctttggcactgtcatctg
tgtccctcgagtacagagcatgccagcgcctcagctaatgggcatgtctcctattcagct
gtgagcagagagaacagctcttcccaggatccacagacagagggcacaaggtga

DBGET integrated database retrieval system