KEGG   Homo sapiens (human): 5818Help
Entry
5818              CDS       T01001                                 

Gene name
NECTIN1, CD111, CLPED1, ED4, HIgR, HV1S, HVEC, OFC7, PRR, PRR1, PVRL1, PVRR, PVRR1, SK-12, nectin-1
Definition
(RefSeq) nectin cell adhesion molecule 1
  KO
K06081  
poliovirus receptor-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Adherens junction
Herpes simplex infection
Disease
H00516  
Isolated orofacial clefts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5818 (NECTIN1)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    5818 (NECTIN1)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    5818 (NECTIN1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   PVRL1; poliovirus receptor-related 1 [KO:K06081]
    5818 (NECTIN1)
   PVRL3; poliovirus receptor-related 3 [KO:K06592]
    5818 (NECTIN1)
   PVRL4; poliovirus receptor-related 4 [KO:K06593]
    5818 (NECTIN1)
   CADM3, IGSF4B, NECL1, TSLL1; cell adhesion molecule 3 [KO:K06780 ]
    5818 (NECTIN1)
 6. Sialomucin Family
  CD96; CD96 antigen [KO:K06517]
   5818 (NECTIN1)
CD molecules [BR:hsa04090]
 Proteins
  5818 (NECTIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15223(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 517 aa AA seqDB search
MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSV
KITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEG
VYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPP
SVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLT
LNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
FFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTAIIGGV
AGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPD
DSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDG
YGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctcggatggggcttgcgggcgccgctggacgctggtggggactcgctctcggcttg
accgcattcttcctcccaggcgtccactcccaggtggtccaggtgaacgactccatgtat
ggcttcatcggcacagacgtggttctgcactgcagctttgccaacccgcttcccagcgtg
aagatcacccaggtcacatggcagaagtccaccaatggctccaagcagaacgtggccatc
tacaacccatccatgggcgtgtccgtgctggctccctaccgcgagcgtgtggaattcctg
cggccctccttcaccgatggcactatccgcctctcccgcctggagctggaggatgagggt
gtctacatctgcgagtttgctaccttccctacgggcaatcgagaaagccagctcaatctc
acggtgatggccaaacccaccaattggatagagggtacccaggcagtgcttcgagccaag
aaggggcaggatgacaaggtcctggtggccacctgcacctcagccaatgggaagcctccc
agtgtggtatcctgggaaactcggttaaaaggtgaggcagagtaccaggagatccggaac
cccaatggcacagtgacggtcatcagccgctaccgcctggtgcccagcagggaagcccac
cagcagtccttggcctgcatcgtcaactaccacatggaccgcttcaaggaaagcctcact
ctcaacgtgcagtatgagcctgaggtaaccattgaggggtttgatggcaactggtacctg
cagcggatggacgtgaagctcacctgcaaagctgatgctaaccccccagccactgagtac
cactggaccacgctaaatggctctctccccaagggtgtggaggcccagaacagaaccctc
ttcttcaagggacccatcaactacagcctggcagggacctacatctgtgaggccaccaac
cccatcggtacacgctcaggccaggtggaggtcaatatcacagaattcccctacaccccg
tctcctcccgaacatgggcggcgcgccgggccggtgcccacggccatcattgggggcgtg
gcggggagcatcctgctggtgttgattgtggtcggcgggatcgtggtcgccctgcgtcgg
cgccggcacaccttcaagggtgactacagcaccaagaagcacgtgtatggcaacggctac
agcaaggcaggcatcccccagcaccacccaccaatggcacagaacctgcagtaccccgac
gactcagacgacgagaagaaggccggcccactgggtggaagcagctatgaggaggaggag
gaggaggaggagggcggtggagggggcgagcgcaaggtgggcggcccccaccccaaatat
gacgaggacgccaagcggccctacttcaccgtggatgaggccgaggcccgtcaggacggc
tacggggaccggactctgggctaccagtacgaccctgagcagctggacttggctgagaac
atggtttctcagaacgacgggtctttcatttccaagaaggagtggtacgtgtag

DBGET integrated database retrieval system