KEGG   Homo sapiens (human): 58191Help
Entry
58191             CDS       T01001                                 

Gene name
CXCL16, CXCLG16, SR-PSOX, SRPSOX
Definition
chemokine (C-X-C motif) ligand 16
Orthology
K10035  
C-X-C motif chemokine 16
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    58191 (CXCL16)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    58191 (CXCL16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13
AA seq 273 aa AA seqDB search
MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCG
KRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKE
CGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSD
KELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAA
LSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggagtcagagcgaggtggctccatccccgcagagtccgcggagccccgagatg
ggacgggacttgcggcccgggtcccgcgtgctcctgctcctgcttctgctcctgctggtg
tacctgactcagccaggcaatggcaacgagggcagcgtcactggaagttgttattgtggt
aaaagaatttcttccgactccccgccatcggttcagttcatgaatcgtctccggaaacac
ctgagagcttaccatcggtgtctatactacacgaggttccagctcctttcctggagcgtg
tgtgggggcaacaaggacccatgggttcaggaattgatgagctgtcttgatctcaaagaa
tgtggacatgcttactcggggattgtggcccaccagaagcatttacttcctaccagcccc
ccaatttctcaggcctcagagggggcatcttcagatatccacacccctgcccagatgctc
ctgtccaccttgcagtccactcagcgccccaccctcccagtaggatcactgtcctcggac
aaagagctcactcgtcccaatgaaaccaccattcacactgcgggccacagtctggcagct
gggcctgaggctggggagaaccagaagcagccggaaaaaaatgctggtcccacagccagg
acatcagccacagtgccagtcctgtgcctcctggccatcatcttcatcctcaccgcagcc
ctttcctatgtgctgtgcaagaggaggagggggcagtcaccgcagtcctctccagatctg
ccggttcattatatacctgtggcacctgactctaatacctga

DBGET integrated database retrieval system