KEGG   Homo sapiens (human): 5826Help
Entry
5826              CDS       T01001                                 

Gene name
ABCD4, ABC41, EST352188, MAHCJ, P70R, P79R, PMP69, PXMP1L
Definition
ATP-binding cassette, sub-family D (ALD), member 4
Orthology
K05678  
ATP-binding cassette, subfamily D (ALD), member 4
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Peroxisome
Disease
H00174  
Methylmalonic aciduria (MMA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    5826 (ABCD4)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    5826 (ABCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 606 aa AA seqDB search
MAVAGPAPGAGARPRLDLQFLQRFLQILKVLFPSWSSQNALMFLTLLCLTLLEQFVIYQV
GLIPSQYYGVLGNKDLEGFKTLTFLAVMLIVLNSTLKSFDQFTCNLLYVSWRKDLTEHLH
RLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQLSSMASKLIISPFTLVYYTYQCFQ
STGWLGPVSIFGYFILGTVVNKTLMGPIVMKLVHQEKLEGDFRFKHMQIRVNAEPAAFYR
AGHVEHMRTDRRLQRLLQTQRELMSKELWLYIGINTFDYLGSILSYVVIAIPIFSGVYGD
LSPAELSTLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQD
CEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLIT
GNTGTGKTSLLRVLGGLWTSTRGSVQMLTDFGPHGVLFLPQKPFFTDGTLREQVIYPLKE
VYPDSGSADDERILRFLELAGLSNLVARTEGLDQQVDWNWYDVLSPGEMQRLSFARLFYL
QPKYAVLDEATSALTEEVESELYRIGQQLGMTFISVGHRQSLEKFHSLVLKLCGGGRWEL
MRIKVE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgcggggcccgcgcccggagctggcgccaggcccaggttagatctgcaattt
ctccagcggttcctgcagatactgaaggttttgtttccttcttggtcatcacaaaatgcc
ttgatgttcctgacccttttgtgcctgaccctactggagcaatttgtgatctaccaggtt
ggcttgatccccagtcagtactatggggtcctgggaaacaaagacttggaagggtttaag
actctgacattcctggctgtcatgctcattgttctgaactccacgctgaagagctttgat
cagttcacctgcaacctgctgtatgtgagctggaggaaggacctcactgagcaccttcac
cgcctctacttccggggccgtgcgtactacaccctcaacgtgctgcgggatgacatcgat
aacccggaccagcgcatcagccaggacgtggagcgattctgccggcagctcagcagcatg
gccagcaagctcatcatctccccgttcaccctcgtctactacacttaccagtgcttccaa
agcacaggctggctcgggcctgtgagcatcttcgggtatttcatcctggggaccgtggtg
aacaaaactttgatgggccccattgtgatgaagctggtgcatcaggagaagctggaggga
gattttaggttcaagcacatgcagattcgggtgaatgcggagcctgctgctttctacaga
gctgggcatgtggagcacatgaggacagaccgcaggctgcagagactccttcagacccag
agggagctgatgtccaaggagctctggctgtacatcggcatcaacacctttgactatctg
ggcagcatcctgagttacgttgtcatcgcaatccccattttcagcggggtctatggagac
ctgagtcccgcagagcttagcaccctggtcagcaagaatgcctttgtgtgcatctacctc
atcagctgcttcacccagctcatcgacctgtccacgacgctctcagatgtggctggctac
acgcacagaattgggcagcttcgggagacgcttctggacatgtccctgaagtcacaggac
tgcgagatcctgggcgagagcgagtggggcttggacacacccccagggtggccagcggca
gagccagcagacacagcatttctccttgagcgggtctccatctctgccccctcctctgac
aaacccctaatcaaggatctgagcctaaagatctccgagggacagagcctgctcatcaca
ggcaacacgggcactggcaagacctccttgctccgggttctgggtggcctctggacgagt
acacggggctcagtgcagatgctgacggactttgggccccatggggtgctattcctgcca
caaaagccattcttcactgacgggacccttcgggagcaggtgatatatcccctgaaggag
gtctaccccgactcaggttctgccgatgatgagaggatcttgaggttcttggaattggca
ggcctgtccaacttggtggcaaggacagagggcctggaccagcaggtggactggaactgg
tatgatgttctgtccccgggggagatgcaacggctctcctttgcccgactcttctacctg
cagccgaagtacgcagtgcttgatgaagccaccagtgccctgacagaggaagtggagagc
gagctctatcgcatcggccagcagctggggatgacgttcatcagtgtgggacatcggcag
agccttgagaagtttcattccttggttctgaaactctgtggaggaggaagatgggagctg
atgagaatcaaagtggaatga

DBGET integrated database retrieval system