KEGG   Homo sapiens (human): 5834Help
Entry
5834              CDS       T01001                                 

Gene name
PYGB, GPBB
Definition
phosphorylase, glycogen; brain (EC:2.4.1.1)
Orthology
K00688  
starch phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5834 (PYGB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5834 (PYGB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     5834 (PYGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11.21
AA seq 843 aa AA seqDB search
MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDTPVPGYKNNTVN
TMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKV
DWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFP
GDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIVKQSVFKDFYELEPEKF
QNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPLVSDEVFIRDVAKVKQ
ENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDPAKAFV
PRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPA
ADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVE
ALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEA
YMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNI
PRD
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccgctgacggacagcgagaagcggaagcagatcagcgtgcgcggcctggcg
gggctaggcgacgtggccgaggtgcggaagagcttcaaccggcacttgcacttcacgctg
gtcaaggaccgcaatgtggccacgccccgcgactacttcttcgcgctggcgcacacggtg
cgcgaccacctcgtgggccgctggatccgcacgcagcagcactactacgagcgcgacccc
aagcgcatttattatctttccctggaattctacatgggtcgcacgctgcagaacacgatg
gtgaacctgggccttcagaatgcctgcgatgaagccatctatcagttggggttagacttg
gaggaactcgaggagatagaagaagatgctggccttgggaatggaggcctggggaggctg
gcagcgtgtttccttgactcaatggctaccttgggcctggcagcatacggctatggaatc
cgctatgaatttgggatttttaaccagaagattgtcaatggctggcaggtagaggaggcc
gatgactggctgcgctacggcaacccctgggagaaagcgcggcctgagtatatgcttccc
gtgcacttctacggacgcgtggagcacacccccgacggcgtgaagtggctggacacacag
gtggtgctggccatgccctacgacaccccagtgcccggctacaagaacaacaccgtcaac
accatgcggctgtggtccgccaaggctcccaacgacttcaagctgcaggacttcaacgtg
ggagactacatcgaggcggtcctggaccggaacttggctgagaacatctccagggtcctg
tatccaaatgataacttctttgaggggaaggagctgcggctgaagcaggagtacttcgtg
gtggccgccacgctccaggacatcatccgccgcttcaagtcgtccaagttcggctgccgg
gaccctgtgagaacctgtttcgagacgttcccagacaaggtggccatccagctgaacgac
acccaccccgccctctccatccctgagctcatgcggatcctggtggacgtggagaaggtg
gactgggacaaggcctgggaaatcacgaagaagacctgtgcatacaccaaccacactgtg
ctgcctgaggccttggagcgctggcccgtgtccatgtttgagaagctgctgccgcggcac
ctggagataatctatgccatcaaccagcggcacctggaccacgtggccgcgctgtttccc
ggcgatgtggaccgcctgcgcaggatgtctgtgatcgaggagggggactgcaagcggatc
aacatggcccacctgtgtgtgattgggtcccatgctgtcaatggtgtggcgaggatccac
tcggagatcgtgaaacagtcggtctttaaggatttttatgaactggagccagagaagttc
cagaataagaccaatggcatcaccccccgccggtggctgctgctgtgcaacccggggctg
gccgataccatcgtggagaaaattggggaggagttcctgactgacctgagccagctgaag
aagctgctgccgctggtcagtgacgaggtgttcatcagggacgtggccaaggtcaaacag
gagaacaagctcaagttctcggccttcctggagaaggagtacaaggtgaagatcaacccc
tcctccatgttcgatgtgcatgtgaagaggatccacgagtacaagcggcagctgctcaac
tgcctgcacgtcgtcaccctgtacaatcgaatcaagagagacccggccaaggcttttgtg
cccaggactgttatgattgggggcaaggcagcgcccggttaccacatggccaagctgatc
atcaagttggtcacctccatcggcgacgtcgtcaatcatgacccagttgtgggtgacagg
ttgaaagtgatcttcctggagaactaccgtgtgtccttggctgagaaagtgatcccggcc
gctgatctgtcgcagcagatctccactgcaggcaccgaggcctcaggcacaggcaacatg
aagttcatgctcaacggggccctcaccatcggcaccatggacggcgccaacgtggagatg
gccgaggaggccggggccgagaacctcttcatcttcggcctgcgggtggaggatgtcgag
gccttggaccggaaagggtacaatgccagggagtactacgaccacctgcccgagctgaag
caggccgtggaccagatcagcagtggctttttttctcccaaggagccagactgcttcaag
gacatcgtgaacatgctgatgcaccatgacaggttcaaggtgtttgcagactatgaagcc
tacatgcagtgccaggcacaggtggaccagctgtaccggaaccccaaggagtggaccaag
aaggtcatcaggaacatcgcctgctcgggcaagttctccagtgaccggaccatcacggag
tatgcacgggagatctggggtgtggagccctccgacctgcagatcccgccccccaacatc
ccccgggactag

DBGET integrated database retrieval system