KEGG   Homo sapiens (human): 5836Help
Entry
5836              CDS       T01001                                 

Gene name
PYGL, GSD6
Definition
(RefSeq) phosphorylase, glycogen, liver (EC:2.4.1.1)
  KO
K00688  
glycogen phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Disease
H00069  
Glycogen storage diseases (GSD)
Drug target
Ingliforib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5836 (PYGL)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5836 (PYGL)
   04922 Glucagon signaling pathway
    5836 (PYGL)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5836 (PYGL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     5836 (PYGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q21-q22
AA seq 847 aa AA seqDB search
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccctgacggaccaggagaagcggcggcagatcagcatccgcggcatcgtg
ggcgtggagaacgtggcagagctgaagaagagtttcaaccggcacctgcacttcacgctg
gtcaaggaccgcaacgtggccaccacccgcgactactacttcgcgctggcgcacacggtg
cgcgaccacctggtggggcgctggatccgcacgcagcagcactactacgacaagtgcccc
aagagggtatattacctctctctggaattttacatgggccgaacattacagaacaccatg
atcaacctcggtctgcaaaatgcctgtgatgaggccatttaccagcttggattggatata
gaagagttagaagaaattgaagaagatgctggacttggcaatggtggtcttgggagactt
gctgcctgcttcttggattccatggcaaccctgggacttgcagcctatggatacggcatt
cggtatgaatatgggattttcaatcagaagatccgagatggatggcaggtagaagaagca
gatgattggctcagatatggaaacccttgggagaagtcccgcccagaattcatgctgcct
gtgcacttctatggaaaagtagaacacaccaacaccgggaccaagtggattgacactcaa
gtggtcctggctctgccatatgacacccccgtgcccggctacatgaataacactgtcaac
accatgcgcctctggtctgctcgggcaccaaatgactttaacctcagagactttaatgtt
ggagactacattcaggctgtgctggaccgaaacctggccgagaacatctcccgggtcctc
tatcccaatgacaatttttttgaagggaaggagctaagattgaagcaggaatactttgtg
gtggctgcaaccttgcaagatatcatccgccgtttcaaagcctccaagtttggctccacc
cgtggtgcaggaactgtgtttgatgccttcccggatcaggtggccatccagctgaatgac
actcaccctgcactcgcgatccctgagctgatgaggatttttgtggatattgaaaaactg
ccctggtccaaggcatgggagctcacccagaagaccttcgcctacaccaaccacacagtg
ctcccggaagccctggagcgctggcccgtggacctggtggagaagctgctccctcgacat
ttggaaatcatttatgagataaatcagaagcatttagatagaattgtggccttgtttcct
aaagatgtggaccgtctgagaaggatgtctctgatagaagaggaaggaagcaaaaggatc
aacatggcccatctctgcattgtcggttcccatgctgtgaatggcgtggctaaaatccac
tcagacatcgtgaagactaaagtattcaaggacttcagtgagctagaacctgacaagttt
cagaataaaaccaatgggatcactccaaggcgctggctcctactctgcaacccaggactt
gcagagctcatagcagagaaaattggagaagactatgtgaaagacctgagccagctgacg
aagctccacagcttcctgggtgatgatgtcttcctccgggaactcgccaaggtgaagcag
gagaataagctgaagttttctcagttcctggagacggagtacaaagtgaagatcaaccca
tcctccatgtttgatgtccaggtgaagaggatacatgagtacaagcgacagctcttgaac
tgtctgcatgtgatcacgatgtacaaccgcattaagaaagaccctaagaagttattcgtg
ccaaggacagttatcattggtggtaaagctgccccaggatatcacatggccaaaatgatc
ataaagctgatcacttcagtggcagatgtggtgaacaatgaccctatggttggaagcaag
ttgaaagtcatcttcttggagaactacagagtatctcttgctgaaaaagtcattccagcc
acagatctgtcagagcagatttccactgcaggcaccgaagcctcggggacaggcaatatg
aagttcatgctaaatggggccctaactatcgggaccatggatggggccaatgtggaaatg
gcagaagaagctggggaagagaacctgttcatctttggcatgaggatagatgatgtggct
gctttggacaagaaagggtacgaggcaaaagaatactatgaggcacttccagagctgaag
ctggtcattgatcaaattgacaatggctttttttctcccaagcagcctgacctcttcaaa
gatatcatcaacatgctattttatcatgacaggtttaaagtctttgcagactacgaagcc
tatgtcaagtgtcaagataaagtgagtcagctgtacatgaatccaaaggcctggaacaca
atggtactcaaaaacatagctgcctcggggaaattctccagtgaccgaacaattaaagaa
tatgcccaaaacatctggaacgtggaaccttcagatctaaagatttctctatccaatgaa
tctaacaaagtcaatggaaattga

DBGET integrated database retrieval system