KEGG   Homo sapiens (human): 58484Help
Entry
58484             CDS       T01001                                 

Gene name
NLRC4, CARD12, CLAN, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR2.1, IPAF
Definition
NLR family, CARD domain containing 4
Orthology
K12805  
NLR family CARD domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Salmonella infection
Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    58484 (NLRC4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    58484 (NLRC4)
   05134 Legionellosis
    58484 (NLRC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p22-p21
AA seq 1024 aa AA seqDB search
MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILK
KGSESCNLFLKSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPL
GEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQ
RIAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPGTIRKQTFMAMLLKLR
QRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDM
TEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMGESEFHSHTQT
TLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDV
LLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSI
SDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNT
TEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFE
HLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEAPETYIPSRAVSLFFNWKQEFR
TLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVE
ASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDA
IKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKIL
AQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLL
KHLEEVPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGV
FENLKQLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFK
LVTA
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcataaaggacaatagccgagcccttattcaaagaatgggaatgactgttata
aagcaaatcacagatgacctatttgtatggaatgttctgaatcgcgaagaagtaaacatc
atttgctgcgagaaggtggagcaggatgctgctagagggatcattcacatgattttgaaa
aagggttcagagtcctgtaacctctttcttaaatcccttaaggagtggaactatcctcta
tttcaggacttgaatggacaaagtctttttcatcagacatcagaaggagacttggacgat
ttggctcaggatttaaaggacttgtaccataccccatcttttctgaacttttatcccctt
ggtgaagatattgacattatttttaacttgaaaagcaccttcacagaacctgtcctgtgg
aggaaggaccaacaccatcaccgcgtggagcagctgaccctgaatggcctcctgcaggct
cttcagagcccctgcatcattgaaggggaatctggcaaaggcaagtccactctgctgcag
cgaattgccatgctctggggctccggaaagtgcaaggctctgaccaagttcaaattcgtc
ttcttcctccgtctcagcagggcccagggtggactttttgaaaccctctgtgatcaactc
ctggatatacctggcacaatcaggaagcagacattcatggccatgctgctgaagctgcgg
cagagggttcttttccttcttgatggctacaatgaattcaagccccagaactgcccagaa
atcgaagccctgataaaggaaaaccaccgcttcaagaacatggtcatcgtcaccactacc
actgagtgcctgaggcacatacggcagtttggtgccctgactgctgaggtgggggatatg
acagaagacagcgcccaggctctcatccgagaagtgctgatcaaggagcttgctgaaggc
ttgttgctccaaattcagaaatccaggtgcttgaggaatctcatgaagacccctctcttt
gtggtcatcacttgtgcaatccagatgggtgaaagtgagttccactctcacacacaaaca
acgctgttccataccttctatgatctgttgatacagaaaaacaaacacaaacataaaggt
gtggctgcaagtgacttcattcggagcctggaccactgtggagacctagctctggagggt
gtgttctcccacaagtttgatttcgaactgcaggatgtgtccagcgtgaatgaggatgtc
ctgctgacaactgggctcctctgtaaatatacagctcaaaggttcaagccaaagtataaa
ttctttcacaagtcattccaggagtacacagcaggacgaagactcagcagtttattgacg
tctcatgagccagaggaggtgaccaaggggaatggttacttgcagaaaatggtttccatt
tcggacattacatccacttatagcagcctgctccggtacacctgtgggtcatctgtggaa
gccaccagggctgttatgaagcacctcgcagcagtgtatcaacacggctgccttctcgga
ctttccatcgccaagaggcctctctggagacaggaatctttgcaaagtgtgaaaaacacc
actgagcaagaaattctgaaagccataaacatcaattcctttgtagagtgtggcatccat
ttatatcaagagagtacatccaaatcagccctgagccaagaatttgaagctttctttcaa
ggtaaaagcttatatatcaactcagggaacatccccgattacttatttgacttctttgaa
catttgcccaattgtgcaagtgccctggacttcattaaactggacttttatgggggagct
atggcttcatgggaaaaggctgcagaagacacaggtggaatccacatggaagaggcccca
gaaacctacattcccagcagggctgtatctttgttcttcaactggaagcaggaattcagg
actctggaggtcacactccgggatttcagcaagttgaataagcaagatatcagatatctg
gggaaaatattcagctctgccacaagcctcaggctgcaaataaagagatgtgctggtgtg
gctggaagcctcagtttggtcctcagcacctgtaagaacatttattctctcatggtggaa
gccagtcccctcaccatagaagatgagaggcacatcacatctgtaacaaacctgaaaacc
ttgagtattcatgacctacagaatcaacggctgccgggtggtctgactgacagcttgggt
aacttgaagaaccttacaaagctcataatggataacataaagatgaatgaagaagatgct
ataaaactagctgaaggcctgaaaaacctgaagaagatgtgtttatttcatttgacccac
ttgtctgacattggagagggaatggattacatagtcaagtctctgtcaagtgaaccctgt
gaccttgaagaaattcaattagtctcctgctgcttgtctgcaaatgcagtgaaaatccta
gctcagaatcttcacaatttggtcaaactgagcattcttgatttatcagaaaattacctg
gaaaaagatggaaatgaagctcttcatgaactgatcgacaggatgaacgtgctagaacag
ctcaccgcactgatgctgccctggggctgtgacgtgcaaggcagcctgagcagcctgttg
aaacatttggaggaggtcccacaactcgtcaagcttgggttgaaaaactggagactcaca
gatacagagattagaattttaggtgcattttttggaaagaaccctctgaaaaacttccag
cagttgaatttggcgggaaatcgtgtgagcagtgatggatggcttgccttcatgggtgta
tttgagaatcttaagcaattagtgttttttgactttagtactaaagaatttctacctgat
ccagcattagtcagaaaacttagccaagtgttatccaagttaacttttctgcaagaagct
aggcttgttgggtggcaatttgatgatgatgatctcagtgttattacaggtgcttttaaa
ctagtaactgcttaa

DBGET integrated database retrieval system