KEGG   Homo sapiens (human): 58497Help
Entry
58497             CDS       T01001                                 

Gene name
PRUNE1, DRES-17, DRES17, H-PRUNE, HTCD37, NMIHBA, PRUNE
Definition
(RefSeq) prune exopolyphosphatase 1
  KO
K01514  
exopolyphosphatase [EC:3.6.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    58497 (PRUNE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     58497 (PRUNE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q86TP1(Tchem)
UniProt: 
Position
1q21.3
AA seq 453 aa AA seqDB search
MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKR
SELPLRGDIVFFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEA
VAEVLDHRPIEPKHCPPCHVSVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDC
VNMDLKIGKATPKDSKYVEKLEALFPDLPKRNDIFDSLQKAKFDVSGLTTEQMLRKDQKT
IYRQGVKVAISAIYMDLEAFLQRSNLLADLHAFCQAHSYDVLVAMTIFFNTHNEPVRQLA
IFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALS
AYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECP
LDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaggactacctgcagggttgtcgagctgctctgcaggagtcccgacctctacatgtt
gtgctgggaaatgaagcctgtgatttggactccacagtgtctgctcttgccctggctttt
tacctagcaaagacaactgaggctgaggaagtctttgtgccagttttaaatataaaacgt
tctgaactacctctgcgaggtgacattgtcttctttcttcagaaggttcatattccagag
agtatcttgatttttcgggatgagattgacctccatgcattataccaggctggccaactc
accctcatccttgtcgaccatcatatcttatccaaaagtgacacagccctagaggaggca
gtagcagaggtgctagaccatcgacccatcgagccgaaacactgccctccctgccatgtt
tcagttgagctggtggggtcctgtgctaccctggtgaccgagagaatcctgcagggggca
ccagagatcttggacaggcaaactgcagcccttctgcatggaaccatcatcctggactgt
gtcaacatggaccttaaaattggaaaggcaaccccaaaggacagcaaatatgtggagaaa
ctagaggcccttttcccagacctacccaagagaaatgatatatttgattccctacaaaag
gcaaagtttgatgtatcaggactgaccactgagcagatgctgagaaaagaccagaagact
atctatagacaaggcgtcaaggtggccattagtgcaatatatatggatttggaggccttt
ctgcagaggtctaacctccttgcagatctccatgctttctgccaggctcacagctatgat
gtcctggttgccatgactatctttttcaacactcacaatgagccagtgcggcagttggct
attttctgtccccatgtggcactccaaacaacgatctgtgaagtcctggaacgctcccac
tctccacccctgaagctgacccctgcctcaagtacccaccctaacctccatgcctatctt
caaggcaacacccaggtctctcgaaagaaacttctgcccctgctccaggaagccctgtca
gcatattttgactccatgaagatcccttcaggacagcctgagacagcagatgtgtccagg
gagcaagtggacaaggaattggacagggcaagtaactccctgatttctggcctgagtcaa
gatgaggaggaccctccgctgcccccgacgcccatgaacagcttggtggatgagtgccct
ctagatcaggggctgcctaaactctctgctgaggccgtcttcgagaagtgcagtcagatc
tcactgtcacagtctaccacagcctccctgtccaagaagtga

DBGET integrated database retrieval system