KEGG   Homo sapiens (human): 58498Help
Entry
58498             CDS       T01001                                 

Gene name
MYL7, MYL2A, MYLC2A
Definition
(RefSeq) myosin light chain 7
  KO
K12754  myosin regulatory light chain 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    58498 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    58498 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    58498 (MYL7)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     58498 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 CHCH EF-hand_9
Motif
Other DBs
NCBI-GeneID: 58498
NCBI-ProteinID: NP_067046
OMIM: 613993
HGNC: 21719
Ensembl: ENSG00000106631
Vega: OTTHUMG00000023125
Pharos: Q01449(Tdark)
UniProt: Q01449
Position
7p13
AA seq 175 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatacaggagttcaaagaagcc
ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaagag
ggcaagggccccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaaaggg
gtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac
aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

DBGET integrated database retrieval system