KEGG   Homo sapiens (human): 58498Help
Entry
58498             CDS       T01001                                 

Gene name
MYL7, MYL2A, MYLC2A
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    58498 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    58498 (MYL7)
   04530 Tight junction
    58498 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    58498 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p21-p11.2
AA seq 175 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatacaggagttcaaagaagcc
ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaagag
ggcaagggccccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaaaggg
gtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac
aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

DBGET integrated database retrieval system