KEGG   Homo sapiens (human): 58508Help
Entry
58508             CDS       T01001                                 

Gene name
KMT2C, HALR, MLL3
Definition
lysine (K)-specific methyltransferase 2C (EC:2.1.1.43)
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    58508 (KMT2C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     58508 (KMT2C)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    58508 (KMT2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 4911 aa AA seqDB search
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKKPRSRGK
TAVEDEDSMDGLETTETETIVETEIKEQSAEEDAEAEVDNSKQLIPTLQRSVSEESANSL
VSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRITPGFILPWRNQPSNKKDIDDNSNGT
YEKMQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQ
ALFDSTGTCWAHHRCVEWSLGVCQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEE
KCTQMYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCT
TCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQP
VMKSVPTNGWKCKNCRICIECGTRSSSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQK
DMLHCNMCKRWVHLECDKPTDHELDTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTT
DYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESLDTDS
LLIAVSSQHTVNTELEKQISNEVDSEDLKMSSEVKHICGEDQIEDKMEVTENIEVVTHQI
TVQQEQLQLLEEPETVVSREESRPPKLVMESVTLPLETLVSPHEESISLCPEEQLVIERL
QGEKEQKENSELSTGLMDSEMTPTIEGCVKDVSYQGGKSIKLSSETESSFSSSADISKAD
VSSSPTPSSDLPSHDMLHNYPSALSSSAGNIMPTTYISVTPKIGMGKPAITKRKFSPGRP
RSKQGAWSTHNTVSPPSWSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRRPRGAG
LSGRGGRGRSKLKSGIGAVVLPGVSTADISSNKDDEENSMHNTVVLFSSSDKFTLNQDMC
VVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPG
RLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAP
CASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRPYM
PASNVPSSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVPRRKRS
KPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPEREAVDDE
TKGVEGTDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPCRDD
GWSEQLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLLDTSRQSK
ISLDNLSEDGAQLLYKTNMNTGFLDPSLDPLLSSSSAPTKSGTHGPADDPLADISEVLNT
DDDILGIISDDLAKSVDHSDIGPVTDDPSSLPQPNVNQSSRPLSEEQLDGILSPELDKMV
TDGAILGKLYKIPELGGKDVEDLFTAVLSPANTQPTPLPQPPPPTQLLPIHNQDAFSRMP
LMNGLIGSSPHLPHNSLPPGSGLGTFSAIAQSSYPDARDKNSAFNPMASDPNNSWTSSAP
TVEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAK
LWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSELFKDPL
KQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQFGSQHLLVQSGSD
TPSSGIQSPLTPQPGNGNMSPAQSFHKELFTKQPPSTPTSTSSDDVFVKPQAPPPPPAPS
RIPIQDSLSQAQTSQPPSPQVFSPGSSNSRPPSPMDPYAKMVGTPRPPPVGHSFSRRNSA
APVENCTPLSSVSRPLQMNETTANRPSPVRDLCSSSTTNNDPYAKPPDTPRPVMTDQFPK
SLGLSRSPVVSEQTAKGPIAAGTSDHFTKPSPRADVFQRQRIPDSYARPLLTPAPLDSGP
GPFKTPMQPPPSSQDPYGSVSQASRRLSVDPYERPALTPRPIDNFSHNQSNDPYSQPPLT
PHPAVNESFAHPSRAFSQPGTISRPTSQDPYSQPPGTPRPVVDSYSQSSGTARSNTDPYS
QPPGTPRPTTVDPYSQQPQTPRPSTQTDLFVTPVTNQRHSDPYAHPPGTPRPGISVPYSQ
PPATPRPRISEGFTRSSMTRPVLMPNQDPFLQAAQNRGPALPGPLVRPPDTCSQTPRPPG
PGLSDTFSRVSPSAARDPYDQSPMTPRSQSDSFGTSQTAHDVADQPRPGSEGSFCASSNS
PMHSQGQQFSGVSQLPGPVPTSGVTDTQNTVNMAQADTEKLRQRQKLREIILQQQQQKKI
AGRQEKGSQDSPAVPHPGPLQHWQPENVNQAFTRPPPPYPGNIRSPVAPPLGPRYAVFPK
DQRGPYPPDVASMGMRPHGFRFGFPGGSHGTMPSQERFLVPPQQIQGSGVSPQLRRSVSV
DMPRPLNNSQMNNPVGLPQHFSPQSLPVQQHNILGQAYIELRHRAPDGRQRLPFSAPPGS
VVEASSNLRHGNFIPRPDFPGPRHTDPMRRPPQGLPNQLPVHPDLEQVPPSQQEQGHSVH
SSSMVMRTLNHPLGGEFSEAPLSTSVPSETTSDNLQITTQPSDGLEEKLDSDDPSVKELD
VKDLEGVEVKDLDDEDLENLNLDTEDGKVVELDTLDNLETNDPNLDDLLRSGEFDIIAYT
DPELDMGDKKSMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLSDKHSPQKKSTVTN
EVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEKTSLHPCDPDLFEK
RTNRETAGPSANVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPSGSPPP
PTLPASPSNHVSSLPPFIAPPGRVLDNAMNSNVTVVSRVNHVFSQGVQVNPGLIPGQSTV
NHSLGTGKPATQTGPQTSQSGTSSMSGPQQLMIPQTLAQQNRERPLLLEEQPLLLQDLLD
QERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNLGMPP
MVMSRFPFMGQVVTGTQNSEGQNLGPQAIPQDGSITHQISRPNPPNFGPGFVNDSQRKQY
EEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQ
QSMVQKQLEQIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMS
QPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPI
KTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVD
RQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMG
QVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLS
GTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDIIPEE
KGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQES
VEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQTYANSEVDKLSMETPAKTEEIKL
EKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNELLKHL
LKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKT
DGGSETKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTHLKQQNNLSNPPTP
PASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDDLLAR
ALAQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPD
LSLVKEEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFGPSPNGPRSGLI
SVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPGLEYRQ
HLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQWCCH
CKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKES
IPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEA
KPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEID
EFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVY
ETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKT
MLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQ
LLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGH
EDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPG
VEACENYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQS
TVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEY
IGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVV
TFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
NT seq 14736 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggaggaggacaagagcgtggagcagccgcagccgccgccaccaccccccgag
gagcctggagccccggccccgagccccgcagccgcagacaaaagacctcggggccggcct
cgcaaagatggcgcttcccctttccagagagccagaaagaaacctcgaagtagggggaaa
actgcagtggaagatgaggacagcatggatgggctggagacaacagaaacagaaacgatt
gtggaaacagaaatcaaagaacaatctgcagaagaggatgctgaagcagaagtggataac
agcaaacagctaattccaactcttcagcgatctgtgtctgaggaatcggcaaactccctg
gtctctgttggtgtagaagccaaaatcagtgaacagctctgcgctttttgttactgtggg
gaaaaaagttccttaggacaaggagacttaaaacaattcagaataacgcctggatttatc
ttgccatggagaaaccaaccttctaacaagaaggacattgatgacaacagcaatggaacc
tatgagaaaatgcaaaactcagcaccacgaaaacaaagaggacagagaaaagaacgatct
cctcagcagaatatagtatcttgtgtaagtgtaagcacccagacagcttcagatgatcaa
gctggtaaactgtgggatgaactcagtctggttgggcttccagatgccattgatatccaa
gccttatttgattctacaggcacttgttgggctcatcaccgttgtgtggagtggtcacta
ggagtatgccagatggaagaaccattgttagtgaacgtggacaaagctgttgtctcaggg
agcacagaacgatgtgcattttgtaagcaccttggagccactatcaaatgctgtgaagag
aaatgtacccagatgtatcattatccttgtgctgcaggagccggcacctttcaggatttc
agtcacatcttcctgctttgtccagaacacattgaccaagctcctgaaagatcgaaggaa
gatgcaaactgtgcagtgtgcgacagcccgggagacctcttagatcagttcttttgtact
acttgtggtcagcactatcatggaatgtgcctggatatagcggttactccattaaaacgt
gcaggttggcaatgtcctgagtgcaaagtgtgccagaactgcaaacaatcgggagaagat
agcaagatgctagtgtgtgatacgtgtgacaaagggtatcatactttttgtcttcaacca
gttatgaaatcagtaccaaccaatggctggaaatgcaaaaattgcagaatatgtatagag
tgtggcacacggtctagttctcagtggcaccacaattgcctgatatgtgacaattgttac
caacagcaggataacttatgtcccttctgtgggaagtgttatcatccagaattgcagaaa
gacatgcttcattgtaatatgtgcaaaaggtgggttcacctagagtgtgacaaaccaaca
gatcatgaactggatactcagctcaaagaagagtatatctgcatgtattgtaaacacctg
ggagctgagatggatcgtttacagccaggtgaggaagtggagatagctgagctcactaca
gattataacaatgaaatggaagttgaaggccctgaagatcaaatggtattctcagagcag
gcagctaataaagatgtcaacggtcaggagtccactcctggaattgttccagatgcggtt
caagtccacactgaagagcaacagaagagtcatccctcagaaagtcttgacacagatagt
cttcttattgctgtatcatcccaacatacagtgaatactgaattggaaaaacagatttct
aatgaagttgatagtgaagacctgaaaatgtcttctgaagtgaagcatatttgtggcgaa
gatcaaattgaagataaaatggaagtgacagaaaacattgaagtcgttacacaccagatc
actgtgcagcaagaacaactgcagttgttagaggaacctgaaacagtggtatccagagaa
gaatcaaggcctccaaaattagtcatggaatctgtcactcttccactagaaaccttagtg
tccccacatgaggaaagtatttcattatgtcctgaggaacagttggttatagaaaggcta
caaggagaaaaggaacagaaagaaaattctgaactttctactggattgatggactctgaa
atgactcctacaattgagggttgtgtgaaagatgtttcataccaaggaggcaaatctata
aagttatcatctgagacagagtcatcattttcatcatcagcagacataagcaaggcagat
gtgtcttcctccccaacaccttcttcagacttgccttcgcatgacatgctgcataattac
ccttcagctcttagttcctctgctggaaacatcatgccaacaacttacatctcagtcact
ccaaaaattggcatgggtaaaccagctattactaagagaaaattttctcctggtagacct
cggtccaaacagggggcttggagtacccataatacagtgagcccaccttcctggtcccca
gacatttcagaaggtcgggaaatttttaaacccaggcagcttcctggcagtgccatttgg
agcatcaaagtgggccgtgggtctggatttccaggaaagcggagacctcgaggtgcagga
ctgtcggggcgaggtggccgaggcaggtcaaagctgaaaagtggaatcggagctgttgta
ttacctggggtgtctactgcagatatttcatcaaataaggatgatgaagaaaactctatg
cacaatacagttgtgttgttttctagcagtgacaagttcactttgaatcaggatatgtgt
gtagtttgtggcagttttggccaaggagcagaaggaagattacttgcctgttctcagtgt
ggtcagtgttaccatccatactgtgtcagtattaagatcactaaagtggttcttagcaaa
ggttggaggtgtcttgagtgcactgtgtgtgaggcctgtgggaaggcaactgacccagga
agactcctgctgtgtgatgactgtgacataagttatcacacctactgcctagaccctcca
ttgcagacagttcccaaaggaggctggaagtgcaaatggtgtgtttggtgcagacactgt
ggagcaacatctgcaggtctaagatgtgaatggcagaacaattacacacagtgcgctcct
tgtgcaagcttatcttcctgtccagtctgctatcgaaactatagagaagaagatcttatt
ctgcaatgtagacaatgtgatagatggatgcatgcagtttgtcagaacttaaatactgag
gaagaagtggaaaatgtagcagacattggttttgattgtagcatgtgcagaccctatatg
cctgcgtctaatgtgccttcctcagactgctgtgaatcttcacttgtagcacaaattgtc
acaaaagtaaaagagctagacccacccaagacttatacccaggatggtgtgtgtttgact
gaatcagggatgactcagttacagagcctcacagttacagttccaagaagaaaacggtca
aaaccaaaattgaaattgaagattataaatcagaatagcgtggccgtccttcagacccct
ccagacatccaatcagagcattcaagggatggtgaaatggatgatagtcgagaaggagaa
cttatggattgtgatggaaaatcagaatctagtcctgagcgggaagctgtggatgatgaa
actaagggagtggaaggaacagatggtgtcaaaaagagaaaaaggaaaccatacagacca
ggtattggtggatttatggtgcggcaaagaagtcgaactgggcaagggaaaaccaaaaga
tctgtgatcagaaaagattcctcaggctctatttccgagcagttaccttgcagagatgat
ggctggagtgagcagttaccagatactttagttgatgaatctgtttctgttactgaaagc
actgaaaaaataaagaagagataccgaaaaaggaaaaataagcttgaagaaactttccct
gcctatttacaagaagctttctttggaaaagatcttctagatacaagtagacaaagcaag
ataagtttagataatctgtcagaagatggagctcagcttttatataaaacaaacatgaac
acaggtttcttggatccttccttagatccactacttagttcatcctcggctccaacaaaa
tctggaactcacggtcctgctgatgacccattagctgatatttctgaagttttaaacaca
gatgatgacattcttggaataatttcagatgatctagcaaaatcagttgatcattcagat
attggtcctgtcactgatgatccttcctctttgcctcagccaaatgtcaatcagagttca
cgaccattaagtgaagaacagctagatgggatcctcagtcctgaactagacaaaatggtc
acagatggagcaattcttggaaaattatataaaattccagagcttggcggaaaagatgtt
gaagacttatttacagctgtacttagtcctgcgaacactcagccaactccattgccacag
cctcccccaccaacacagctgttgccaatacacaatcaggatgctttttcacggatgcct
ctcatgaatggccttattggatccagtcctcatctcccacataattctttgccacctgga
agcggactgggaactttctctgcaattgcacaatcctcttatcctgatgccagggataaa
aattcagcctttaatccaatggcaagtgatcctaacaactcttggacatcatcagctccc
actgtggaaggagaaaatgacacaatgtcgaatgcccagagaagcacgcttaagtgggag
aaagaggaggctctgggtgaaatggcaactgttgccccagttctctacaccaatattaat
ttccccaacttaaaggaagaattccctgattggactactagagtgaagcaaattgccaaa
ttgtggagaaaagcaagctcacaagaaagagcaccatatgtgcaaaaagccagagataac
agagctgctttacgcattaataaagtacagatgtcaaatgattccatgaaaaggcagcaa
cagcaagatagcattgatcccagctctcgtattgattcggagctttttaaagatccttta
aagcaaagagaatcagaacatgaacaggaatggaaatttagacagcaaatgcgtcagaaa
agtaagcagcaagctaaaattgaagccacacagaaacttgaacaggtgaaaaatgagcag
cagcagcagcaacaacagcaatttggttctcagcatcttctggtgcagtctggttcagat
acaccaagtagtgggatacagagtcccttgacacctcagcctggcaatggaaatatgtct
cctgcacagtcattccataaagaactgtttacaaaacagccacccagtacccctacgtct
acatcttcagatgatgtgtttgtaaagccacaagctccacctcctcctccagccccatcc
cggattcccatccaggatagtctttctcaggctcagacttctcagccaccctcaccgcaa
gtgttttcacctgggtcctctaactcacgaccaccatctccaatggatccatatgcaaaa
atggttggtacccctcgaccacctcctgtgggccatagtttttccagaagaaattctgct
gcaccagtggaaaactgtacacctttatcatcggtatctaggccccttcaaatgaatgag
acaacagcaaataggccatcccctgtcagagatttatgttcttcttccacgacaaataat
gacccctatgcaaaacctccagacacacctaggcctgtgatgacagatcaatttcccaaa
tccttgggcctatcccggtctcctgtagtttcagaacaaactgcaaaaggccctatagca
gctggaaccagtgatcactttactaaaccatctcctagggcagatgtgtttcaaagacaa
aggatacctgactcatatgcacgacccttgttgacacctgcacctcttgatagtggtcct
ggaccttttaagactccaatgcaacctcctccatcctctcaggatccttatggatcagtg
tcacaggcatcaaggcgattgtctgttgacccttatgaaaggcctgctttgacaccaaga
cctatagataatttttctcataatcagtcaaatgatccatatagtcagcctccccttacc
ccacatccagcagtgaatgaatcttttgcccatccttcaagggctttttcccagcctgga
accatatcaaggccaacatctcaggacccatactcccaacccccaggaactccacgacct
gttgtagattcttattcccaatcttcaggaacagctaggtccaatacagacccttactct
caacctcctggaactccccggcctactactgttgacccatatagtcagcagccccaaacc
ccaagaccatctacacaaactgacttgtttgttacacctgtaacaaatcagaggcattct
gatccatatgctcatcctcctggaacaccaagacctggaatttctgtcccttactctcag
ccaccagcaacaccaaggccaaggatttcagagggttttactaggtcctcaatgacaaga
ccagtcctcatgccaaatcaggatcctttcctgcaagcagcacaaaaccgaggaccagct
ttacctggcccgttggtaaggccacctgatacatgttcccagacacctaggccccctgga
cctggtctttcagacacatttagccgtgtttccccatctgctgcccgtgatccctatgat
cagtctccaatgactccaagatctcagtctgactcttttggaacaagtcaaactgcccat
gatgttgctgatcagccaaggcctggatcagaggggagcttctgtgcatcttcaaactct
ccaatgcactcccaaggccagcagttctctggtgtctcccaacttcctggacctgtgcca
acttcaggagtaactgatacacagaatactgtaaatatggcccaagcagatacagagaaa
ttgagacagcggcagaagttacgtgaaatcattctccagcagcaacagcagaagaagatt
gcaggtcgacaggagaaggggtcacaggactcacccgcagtgcctcatccagggcctctt
caacactggcaaccagagaatgttaaccaggctttcaccagacccccacctccctatcct
gggaacattaggtctcctgttgcccctcctttaggacctagatatgctgttttcccaaaa
gatcagcgtggaccctatcctcctgatgttgctagtatggggatgagacctcatggattt
agatttggatttccaggaggtagtcatggtaccatgccgagtcaagagcgcttccttgtg
cctcctcagcaaatacagggatctggagtttctccacagctaagaagatcagtatctgta
gatatgcctaggcctttaaataactcacaaatgaataatccagttggacttcctcagcat
ttttcaccacagagcttgccagttcagcagcacaacatactgggccaagcatatattgaa
ctgagacatagggctcctgacggaaggcaacggctgcctttcagtgctccacctggcagc
gttgtagaggcatcttctaatctgagacatggaaacttcattccccggccagactttccg
ggccctagacacacagaccccatgcgacgacctccccagggtctacctaatcagctacct
gtgcacccagatttggaacaagtgccaccatctcaacaagagcaaggtcattctgtccat
tcatcttctatggtcatgaggactctgaaccatccactaggtggtgaattttcagaagct
cctttgtcaacatctgtaccgtctgaaacaacgtctgataatttacagataaccacccag
ccttctgatggtctagaggaaaaacttgattctgatgacccttctgtgaaggaactggat
gttaaagaccttgagggggttgaagtcaaagacttagatgatgaagatcttgaaaactta
aatttagatacagaggatggcaaggtagttgaattggatactttagataatttggaaact
aatgatcccaacctggatgacctcttaaggtcaggagagtttgatatcattgcatataca
gatccagaacttgacatgggagataagaaaagcatgtttaatgaggaactagaccttcca
attgatgataagttagataatcagtgtgtatctgttgaaccaaaaaaaaaggaacaagaa
aacaaaactctggttctctctgataaacattcaccacagaaaaaatccactgttaccaat
gaggtaaaaacggaagtactgtctccaaattctaaggtggaatccaaatgtgaaactgaa
aaaaatgatgagaataaagataatgttgacactccttgctcacaggcttctgctcactca
gacctaaatgatggagaaaagacttctttgcatccttgtgatccagatctatttgagaaa
agaaccaatcgagaaactgctggccccagtgcaaatgtcattcaggcatccactcaacta
cctgctcaagatgtaataaactcttgtggcataactggatcaactccagttctctcaagt
ttacttgctaatgagaaatctgataattcagacattaggccatcggggtctccaccacca
ccaactctgccggcctccccatccaatcatgtgtcaagtttgcctcctttcatagcaccg
cctggccgtgttttggataatgccatgaattctaatgtgacagtagtctctagggtaaac
catgttttttctcagggtgtgcaggtaaacccagggctcattccaggtcaatcaacagtt
aaccacagtctggggacaggaaaacctgcaactcaaactgggcctcaaacaagtcagtct
ggtaccagtagcatgtctggaccccaacagctaatgattcctcaaacattagcacagcag
aatagagagaggccccttcttctagaagaacagcctctacttctacaggatcttttggat
caagaaaggcaagaacagcagcagcaaagacagatgcaagccatgattcgtcagcgatca
gaaccgttcttccctaatattgattttgatgcaattacagatcctataatgaaagccaaa
atggtggcccttaaaggtataaataaagtgatggcacaaaacaatctgggcatgccacca
atggtgatgagcaggttcccttttatgggccaggtggtaactggaacacagaacagtgaa
ggacagaaccttggaccacaggccattcctcaggatggcagtataacacatcagatttct
aggcctaatcctccaaattttggtccaggctttgtcaatgattcacagcgtaagcagtat
gaagagtggctccaggagacccaacagctgcttcaaatgcagcagaagtatcttgaagaa
caaattggtgctcacagaaaatctaagaaggccctttcagctaaacaacgtactgccaag
aaagctgggcgtgaatttccagaggaagatgcagaacaactcaagcatgttactgaacag
caaagcatggttcagaaacagctagaacagattcgtaaacaacagaaagaacatgctgaa
ttgattgaagattatcggatcaaacagcagcagcaatgtgcaatggccccacctaccatg
atgcccagtgtccagccccagccacccctaattccaggtgccactccacccaccatgagc
caacccacctttcccatggtgccacagcagcttcagcaccagcagcacacaacagttatt
tctggccatactagccctgttagaatgcccagtttacctggatggcaacccaacagtgct
cctgcccacctgcccctcaatcctcctagaattcagcccccaattgcccagttaccaata
aaaacttgtacaccagccccagggacagtctcaaatgcaaatccacagagtggaccacca
cctcgggtagaatttgatgacaacaatccctttagtgaaagttttcaagaacgggaacgt
aaggaacgtttacgagaacagcaagagagacaacggatccaactcatgcaggaggtagat
agacaaagagctttgcagcagaggatggaaatggagcagcatggtatggtgggctctgag
ataagtagtagtaggacatctgtgtcccagattcccttctacagttccgacttaccttgt
gattttatgcaacctctaggaccccttcagcagtctccacaacaccaacagcaaatgggg
caggttttacagcagcagaatatacaacaaggatcaattaattcaccctccacccaaact
ttcatgcagactaatgagcgaaggcaggtaggccctccttcatttgttcctgattcacca
tcaatccctgttggaagcccaaatttttcttctgtgaagcagggacatggaaatctttct
gggaccagcttccagcagtccccagtgaggccttcttttacacctgctttaccagcagca
cctccagtagctaatagcagtctcccatgtggccaagattctactataacccatggacac
agttatccgggatcaacccaatcgctcattcagttgtattctgatataatcccagaggaa
aaagggaaaaagaaaagaacaagaaagaagaaaagagatgatgatgcagaatccaccaag
gctccatcaactccccattcagatataactgccccaccgactccaggcatctcagaaact
acctctactcctgcagtgagcacacccagtgagcttcctcaacaagccgaccaagagtcg
gtggaaccagtcggcccatccactcccaatatggcagcaggccagctatgtacagaatta
gagaacaaactgcccaatagtgatttctcacaagcaactccaaatcaacagacgtatgca
aattcagaagtagacaagctctccatggaaacccctgccaaaacagaagagataaaactg
gaaaaggctgagacagagtcctgcccaggccaagaggagcctaaattggaggaacagaat
ggtagtaaggtagaaggaaacgctgtagcctgtcctgtctcctcagcacagagtcctccc
cattctgctggggcccctgctgccaaaggagactcagggaatgaacttctgaaacacttg
ttgaaaaataaaaagtcatcttctcttttgaatcaaaaacctgagggcagtatttgttca
gaagatgactgtacaaaggataataaactagttgagaagcagaacccagctgaaggactg
caaactttgggggctcaaatgcaaggtggttttggatgtggcaaccagttgccaaaaaca
gatggaggaagtgaaaccaagaaacagcgaagcaaacggactcagaggacgggtgagaaa
gcagcacctcgctcaaagaaaaggaaaaaggacgaagaggagaaacaagctatgtactct
agcactgacacgtttacccacttgaaacagcagaataatttaagtaatcctccaacaccc
cctgcctctcttcctcctacaccacctcctatggcttgtcagaagatggccaatggtttt
gcaacaactgaagaacttgctggaaaagccggagtgttagtgagccatgaagttaccaaa
actctaggacctaaaccatttcagctgcccttcagaccccaggacgacttgttggcccga
gctcttgctcagggccccaagacagttgatgtgccagcctccctcccaacaccacctcat
aacaatcaggaagaattaaggatacaggatcactgtggtgatcgagatactcctgacagt
tttgttccctcatcctctcctgagagtgtggttggggtagaagtgagcaggtatccagat
ctgtcattggtcaaggaggagcctccagaaccggtgccgtcccccatcattccaattctt
cctagcactgctgggaaaagttcagaatcaagaaggaatgacatcaaaactgagccaggc
actttatattttgcgtcaccttttggtccttccccaaatggtcccagatcaggtcttata
tctgtagcaattactctgcatcctacagctgctgagaacattagcagtgttgtggctgca
ttttccgaccttcttcacgtccgaatccctaacagctatgaggttagcagtgctccagat
gtcccatccatgggtttggtcagtagccacagaatcaacccgggtttggagtatcgacag
catttacttctccgtgggcctccgccaggatctgcaaaccctcccagattagtgagctct
taccggctgaagcagcctaatgtaccatttcctccaacaagcaatggtctttctggatat
aaggattctagtcatggtattgcagaaagcgcagcactcagaccacagtggtgttgtcat
tgtaaagtggttattcttggaagtggtgtgcggaaatctttcaaagatctgacccttttg
aacaaggattcccgagaaagcaccaagagggtagagaaggacattgtcttctgtagtaat
aactgctttattctttattcatcaactgcacaagcgaaaaactcagaaaacaaggaatcc
attccttcattgccacaatcacctatgagagaaacgccttccaaagcatttcatcagtac
agcaacaacatctccactttggatgtgcactgtctcccccagctcccagagaaagcttct
ccccctgcctcaccacccatcgccttccctcctgcttttgaagcagcccaagtcgaggcc
aagccagatgagctgaaggtgacagtcaagctgaagcctcggctaagagctgtccatggt
gggtttgaagattgcaggccgctcaataaaaaatggagaggaatgaaatggaagaagtgg
agcattcatattgtaatccctaaggggacatttaaaccaccttgtgaggatgaaatagat
gaatttctaaagaaattgggcacttcccttaaacctgatcctgtgcccaaagactatcgg
aaatgttgcttttgtcatgaagaaggtgatggattgacagatggaccagcaaggctactc
aaccttgacttggatctgtgggtccacttgaactgcgctctgtggtccacggaggtctat
gagactcaggctggtgccttaataaatgtggagctagctctgaggagaggcctacaaatg
aaatgtgtcttctgtcacaagacgggtgccactagtggatgccacagatttcgatgcacc
aacatttatcacttcacttgcgccattaaagcacaatgcatgttttttaaggacaaaact
atgctttgccccatgcacaaaccaaagggaattcatgagcaagaattaagttactttgca
gtcttcaggagggtctatgttcagcgtgatgaggtgcgacagattgctagcatcgtgcaa
cgaggagaacgggaccatacctttcgcgtgggtagcctcatcttccacacaattggtcag
ctgcttccacagcagatgcaagcattccattctcctaaagcactcttccctgtgggctat
gaagccagccggctgtactggagcactcgctatgccaataggcgctgccgctacctgtgc
tccattgaggagaaggatgggcgcccagtgtttgtcatcaggattgtggaacaaggccat
gaagacctggttctaagtgacatctcacctaaaggtgtctgggataagattttggagcct
gtggcatgtgtgagaaaaaagtctgaaatgctccagcttttcccagcgtatttaaaagga
gaggatctgtttggcctgaccgtctctgcagtggcacgcatagcggaatcacttcctggg
gttgaggcatgtgaaaattataccttccgatacggccgaaatcctctcatggaacttcct
cttgccgttaaccccacaggttgtgcccgttctgaacctaaaatgagtgcccatgtcaag
aggtttgtgttaaggcctcacaccttaaacagcaccagcacctcaaagtcatttcagagc
acagtcactggagaactgaacgcaccttatagtaaacagtttgttcactccaagtcatcg
cagtaccggaagatgaaaactgaatggaaatccaatgtgtatctggcacggtctcggatt
caggggctgggcctgtatgctgctcgagacattgagaaacacaccatggtcattgagtac
atcgggactatcattcgaaacgaagtagccaacaggaaagagaagctttatgagtctcag
aaccgtggtgtgtacatgttccgcatggataacgaccatgtgattgacgcgacgctcaca
ggagggcccgcaaggtatatcaaccattcgtgtgcacctaattgtgtggctgaagtggtg
acttttgagagaggacacaaaattatcatcagctccagtcggagaatccagaaaggagaa
gagctctgctatgactataagtttgactttgaagatgaccagcacaagattccgtgtcac
tgtggagctgtgaactgccggaagtggatgaactga

DBGET integrated database retrieval system