KEGG   Homo sapiens (human): 58511Help
Entry
58511             CDS       T01001                                 

Gene name
DNASE2B, DLAD
Definition
deoxyribonuclease II beta (EC:3.1.22.1)
Orthology
K01158  
deoxyribonuclease II [EC:3.1.22.1]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22.3
AA seq 361 aa AA seqDB search
MKQKMMARLLRTSFALLFLGLFGVLGAATISCRNEEGKAVDWFTFYKLPKRQNKESGETG
LEYLYLDSTTRSWRKSEQLMNDTKSVLGRTLQQLYEAYASKSNNTAYLIYNDGVPKPVNY
SRKYGHTKGLLLWNRVQGFWLIHSIPQFPPIPEEGYDYPPTGRRNGQSGICITFKYNQYE
AIDSQLLVCNPNVYSCSIPATFHQELIHMPQLCTRASSSEIPGRLLTTLQSAQGQKFLHF
AKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFS
SYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESC
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaatgatggcaagactgctaagaacatcctttgctttgctcttccttggc
ctctttggggtgctgggggcagcaacaatttcatgcagaaatgaagaagggaaagctgtg
gactggtttactttttataagttacctaaaagacaaaacaaggaaagtggagagactggg
ttagagtacctgtacctagactctacaactagaagctggaggaagagtgagcaactaatg
aatgacaccaagagtgttttgggaaggacattacaacagctatatgaagcatatgcctct
aagagtaacaacacagcctatctaatatacaatgatggagtccctaaacctgtgaattac
agcagaaagtatggacacaccaaaggtttactgctgtggaacagagttcaagggttctgg
ctgattcattccatccctcagtttcctccaattccggaagaaggctatgattatccaccc
acagggagacgaaatggacaaagtggcatctgcataactttcaagtacaaccagtatgag
gcaatagattctcagctcttggtctgcaaccccaacgtctatagctgctccatcccagcc
acctttcaccaggagctcattcacatgccccagctgtgcaccagggccagctcatcagag
attcctggcaggctcctcaccacacttcagtcggcccagggacaaaaattcctccatttt
gcaaagtcggattcttttcttgacgacatctttgcagcctggatggctcaacggctgaag
acacacttgttaacagaaacctggcagcgaaaaagacaagagcttccttcaaactgctcc
cttccttaccatgtctacaatataaaagcaattaaattatcacgacactcttatttcagt
tcttatcaagatcatgccaagtggtgtatttcccaaaagggcaccaaaaatcgctggaca
tgtattggagacctaaatcggagtccacaccaagccttcagaagtggaggattcatttgt
acccagaattggcaaatttaccaagcatttcaaggattagtattatactatgaaagctgt
aagtaa

DBGET integrated database retrieval system