KEGG   Homo sapiens (human): 58517Help
Entry
58517             CDS       T01001                                 

Gene name
RBM25, NET52, RED120, RNPC7, S164, Snu71, fSAP94
Definition
(RefSeq) RNA binding motif protein 25
  KO
K12822  
RNA-binding protein 25
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    58517 (RBM25)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    58517 (RBM25)
 Complex B
    58517 (RBM25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49756(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.2
AA seq 843 aa AA seqDB search
MSFPPHLNRPPMGIPALPPGIPPPQFPGFPPPVPPGTPMIPVPMSIMAPAPTVLVPTVSM
VGKHLGARKDHPGLKAKENDENCGPTTTVFVGNISEKASDMLIRQLLAKCGLVLSWKRVQ
GASGKLQAFGFCEYKEPESTLRALRLLHDLQIGEKKLLVKVDAKTKAQLDEWKAKKKASN
GNARPETVTNDDEEALDEETKRRDQMIKGAIEVLIREYSSELNAPSQESDSHPRKKKKEK
KEDIFRRFPVAPLIPYPLITKEDINAIEMEEDKRDLISREISKFRDTHKKLEEEKGKKEK
ERQEIEKERRERERERERERERREREREREREREREKEKERERERERDRDRDRTKERDRD
RDRERDRDRDRERSSDRNKDRSRSREKSRDRERERERERERERERERERERERERERERE
REREREKDKKRDREEDEEDAYERRKLERKLREKEAAYQERLKNWEIRERKKTREYEKEAE
REEERRREMAKEAKRLKEFLEDYDDDRDDPKYYRGSALQKRLRDREKEMEADERDRKREK
EELEEIRQRLLAEGHPDPDAELQRMEQEAERRRQPQIKQEPESEEEEEEKQEKEEKREEP
MEEEEEPEQKPCLKPTLRPISSAPSVSSASGNATPNTPGDESPCGIIIPHENSPDQQQPE
EHRPKIGLSLKLGASNSPGQPNSVKRKKLPVDSVFNKFEDEDSDDVPRKRKLVPLDYGED
DKNATKGTVNTEEKRKHIKSLIEKIPTAKPELFAYPLDWSIVDSILMERRIRPWINKKII
EYIGEEEATLVDFVCSKVMAHSSPQSILDDVAMVLDEEAEVFIVKMWRLLIYETEAKKIG
LVK
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttccacctcatttgaatcgccctcccatgggaatcccagcactcccaccaggg
atcccacccccgcagtttccaggatttcctccacctgtacctccagggaccccaatgatt
cctgtaccaatgagcattatggctcctgctccaactgtcttagtacccactgtgtctatg
gttggaaagcatttgggcgcaagaaaggatcatccaggcttaaaggctaaagaaaatgat
gaaaattgtggtcctactaccactgtttttgttggcaacatttccgagaaagcttcagac
atgcttataagacaactcttagctaaatgtggtttggttttgagctggaagagagtacaa
ggtgcttccggaaagcttcaagccttcggattctgtgagtacaaggagccagaatctacc
ctccgtgcactcagattattacatgacctgcaaattggagagaaaaagctactcgttaaa
gttgatgcaaagacaaaggcacagctggatgaatggaaagcaaagaagaaagcttctaat
gggaatgcaaggccagaaactgtcactaatgacgatgaagaagccttggatgaagaaaca
aagaggagagatcagatgattaaaggggctattgaagttttaattcgtgaatactccagt
gagctaaatgccccctcacaggaatctgattctcaccccaggaagaagaagaaggaaaag
aaggaggacattttccgcagatttccagtggccccactgatcccttatccactcatcact
aaggaggatataaatgctatagaaatggaagaagacaaaagagacctgatatctcgagag
atcagcaaattcagagacacacataagaaactggaagaagagaaaggcaaaaaggaaaaa
gaaagacaggaaattgagaaagaacggagagaaagagagagggagcgtgaaagggaacga
gaaaggcgagaacgggaacgagaaagggaaagagaacgtgaacgagaaaaggagaaagaa
cgggagcgggaacgagaacgggatagggaccgtgaccggacaaaagagagagaccgagat
cgggatcgagagagagatcgtgaccgggatagagaaaggagctcagatcgtaataaggat
cgcagtcgatcaagagaaaaaagcagagatcgtgaaagggaacgagagcgggaaagagag
agagagagagaacgagagcgagaacgagaacgggagcgagagagagagcgagagagggaa
cgggagcgagaaagagaaaaagacaaaaaacgggaccgagaagaagatgaagaagatgca
tacgaacgaagaaaacttgaaagaaaactccgagagaaagaagctgcttatcaagagcgc
cttaagaattgggaaatcagagaacgaaagaaaacccgggaatatgagaaagaagctgaa
agagaagaagaaagaagaagagaaatggccaaagaagctaaacgactaaaagaattctta
gaagactatgatgatgatagagatgaccccaaatattacagaggaagtgctcttcagaaa
aggttgcgtgatagagaaaaggaaatggaagcagatgaacgagataggaagagagagaag
gaggagcttgaggaaatcaggcagcgccttctggcagaagggcatccagatccagatgca
gagctccagaggatggaacaagaggctgagaggcgcaggcagccacaaataaagcaagag
ccagaatcagaagaggaggaagaagaaaagcaagaaaaagaagaaaaacgagaagaaccc
atggaagaggaagaggagccagagcaaaagccttgtctgaaacctactctgaggcccatc
agctctgctccatctgtttcctctgccagtggcaatgcaacacctaacactcctggggat
gagtctccctgtggtattattattcctcatgaaaactcaccagatcaacagcaacctgag
gagcataggccaaaaataggactaagtcttaaactgggtgcttccaatagtcctggtcag
cctaattctgtgaagagaaagaaactacctgtagatagtgtctttaacaaatttgaggat
gaagacagtgatgacgtaccccgaaaaaggaaactggttcccttggattatggtgaagat
gataaaaatgcaaccaaaggcactgtaaacactgaagaaaagcgtaaacacattaagagt
ctcattgagaaaatccctacagccaaacctgagctcttcgcttatcccctggattggtct
attgtggattctatactgatggaacgtcgaattagaccatggattaataagaaaatcata
gaatatataggtgaagaagaagctacattagttgattttgtttgttctaaggttatggct
catagttcaccccagagcattttagatgatgttgccatggtacttgatgaagaagcagaa
gtttttatagtcaaaatgtggagattattgatatatgaaacagaagccaagaaaattggt
cttgtgaagtaa

DBGET integrated database retrieval system