KEGG   Homo sapiens (human): 58528Help
Entry
58528             CDS       T01001                                 

Gene name
RRAGD, RAGD, bA11D8.2.1
Definition
Ras-related GTP binding D
Orthology
K16186  
Ras-related GTP-binding protein C/D
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    58528 (RRAGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q15-q16
AA seq 400 aa AA seqDB search
MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTE
VKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPG
QIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHK
VDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLIPQ
LPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIY
GLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNFHCF
RKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggtgctggggaagccgcagccgcaggacgaggacgacgcggaggaggaggag
gaggaggatgagctggtggggctagcggactacggagacgggcccgactcctccgacgcc
gatccggacagcggcacagaggagggagttctggacttcagtgaccccttcagcactgaa
gtgaagccgagaatcctgctcatgggcctgaggagaagcggcaagtcgtctattcagaaa
gttgtctttcacaaaatgtctcccaacgaaactctgttcttggagagcactaataagata
tgccgggaagatgtttccaacagctcctttgtcaattttcagatttgggacttcccagga
cagattgacttttttgaccctacatttgactatgagatgatcttccggggaacaggagca
ctgatatttgtcattgactcacaggatgattacatggaagccctggccaggctccacctc
acggtgaccagggcctacaaagtgaatactgacatcaacttcgaggtgtttattcataaa
gtggatggtctgtcagatgaccacaaaattgaaacccaaagagatattcaccagagggca
aacgatgaccttgcagatgctggattagaaaaaattcacctcagcttttatctgacaagc
atatatgatcattcaatatttgaagcttttagcaaagttgttcagaaactgattccacaa
ctcccaactctggagaatttgctgaacatctttatctcaaattctggaattgaaaaggca
tttctatttgatgtggtcagtaaaatttatattgcaactgatagtactccggtggatatg
caaacctatgagctctgctgtgatatgatagatgtggttattgacatctcttgtatttat
ggtctcaaagaagatggagcaggaaccccctatgacaaggaatccacagccatcataaag
cttaataatacaaccgtgctttatttaaaagaggtgacaaagttcctggctctcgtttgc
tttgtcagagaggaaagctttgaaagaaaagggctaattgactataattttcattgcttc
cggaaggccattcatgaagtttttgaggtgagaatgaaagtagtaaaatctcgaaaggtt
cagaatcggctgcagaagaaaaagagagccacccctaatgggacccctagagtgctgctg
tag

DBGET integrated database retrieval system