KEGG   Homo sapiens (human): 5859Help
Entry
5859              CDS       T01001                                 

Gene name
QARS, GLNRS, PRO2195
Definition
glutaminyl-tRNA synthetase (EC:6.1.1.18)
Orthology
K01886  
glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hsa00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 764 aa AA seqDB search
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLA
SRLRDTRRLSFLVSYIATALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAIN
RHRPQLLVERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKV
AKARLEETDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMN
LLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEE
AKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGHNTL
PSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRVKYTPHHRTGDK
WCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLHY
AVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPH
LLEACVRDVLNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPI
VFIERTDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAG
EKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCS
VALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctagactccctgtcgctcttcactagcctcggcctgagcgagcagaaggcc
cgcgagacgctcaagaactcggctctgagcgcgcagctgcgcgaggccgctactcaggct
cagcagaccctgggttccaccattgacaaagctaccgggatcctgttatatggcttggcc
tcccgactcagggatacccggcgtctctccttccttgtaagctacatagccactgccctt
gagtatgtgcggagtcaccccttggaccccatcgacactgtggacttcgagcgggaatgt
ggcgtgggtgtcattgtgaccccagagcagattgaggaggctgtggaggctgctattaac
aggcaccggccccagctcctggtggaacgttaccatttcaacatggggctgctgatggga
gaggctcgggctgtgctgaagtgggcagatggcaaaatgatcaagaatgaagtggacatg
caggtcctccaccttctgggccccaagttggaggctgatctggagaagaagttcaaggtg
gcaaaagctcggctagaagaaacagaccggaggacggcaaaggatgtggtggagaatggc
gagactgctgaccagaccctgtctctgatggagcagctccggggggaggcccttaagttc
cacaagcctggtgagaactacaagaccccaggctatgtggtcactccacacaccatgaat
ctactaaagcagcacctggagattactggtgggcaggtacgtacccggttcccgccagaa
cccaatggaatcctgcatattggacatgccaaagccatcaatttcaactttggctatgcc
aaggccaacaatggcatctgttttctgcgttttgatgacaccaaccctgagaaggaggaa
gcaaagttcttcacggccatctgtgacatggtagcctggctaggctacacaccttacaaa
gtcacatatgcgtctgactattttgaccagctatatgcgtgggctgtggagctcatccgc
aggggtctggcttatgtgtgccaccagcgaggagaggagctcaaaggccataatactctg
ccttcaccctggagagaccgtcccatggaggagtcactgctgctctttgaggcaatgcgc
aagggcaagttttcagagggcgaggccacactacggatgaagctggtgatggaggatggc
aagatggaccctgtagcctatcgagtcaagtatacaccacaccaccgcacaggggacaaa
tggtgcatctatcccacctacgactacacacactgcctctgtgactccatcgagcacatc
actcactcactctgcaccaaggaattccaggcccgacgctcttcctacttctggctttgc
aatgcactggacgtctattgccctgtgcagtgggagtatggccgcctcaacctgcactat
gctgttgtctctaagaggaagatcctccagcttgtagcaactggtgctgtgcgggactgg
gatgacccacggctctttacactcacggccctgcgacggcggggcttcccacctgaggcc
atcaacaacttctgtgcccgggtgggagtgactgtggcacaaaccacaatggagccacat
cttctagaagcctgtgtgcgtgatgtgctgaatgacacagccccacgagccatggctgtg
ctggagtcactacgggtcatcatcaccaactttcctgctgccaagtccttggacatccag
gtgcccaacttcccagctgatgagaccaaaggcttccatcaggttccctttgcacccatt
gtcttcattgagaggactgacttcaaggaggagccagagccaggatttaagcgcctggct
tggggccagcctgtgggcctgaggcatacaggctacgtcattgagctgcagcatgttgtc
aagggccccagtggttgtgtagagagtctggaggtgacctgcagacgggcagatgctgga
gagaagccaaaggcctttattcactgggtgtcacagcctttgatgtgtgaggttcgcctc
tatgagcgactattccagcacaagaaccctgaagatcctactgaggtgcctggtggattt
ttaagtgacctgaacctggcatcactacacgtggtggatgcagcattagtggactgctct
gtggccctggcaaaacccttcgacaagttccagtttgagcgtcttggatatttctccgtg
gatccagacagccatcagggaaagcttgtctttaaccgaactgtcacactgaaggaagac
ccaggaaaggtgtga

DBGET integrated database retrieval system