KEGG   Homo sapiens (human): 5859Help
Entry
5859              CDS       T01001                                 

Gene name
QARS, GLNRS, MSCCA, PRO2195
Definition
glutaminyl-tRNA synthetase (EC:6.1.1.18)
Orthology
K01886  
glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Disease
H00269  
Primary microcephaly (MCPH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    5859 (QARS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     5859 (QARS)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   5859 (QARS)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    5859 (QARS)
 Prokaryotic Type
   Other AARSs
    5859 (QARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 764 aa AA seqDB search
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLA
SRLRDTRRLSFLVSYIATALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAIN
RHRPQLLVERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKV
AKARLEETDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMN
LLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEE
AKFFTAICDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGHNTL
PSPWRDRPMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRVKYTPHHRTGDK
WCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLHY
AVVSKRKILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPH
LLEACVRDVLNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPI
VFIERTDFKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAG
EKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCS
VALAKPFDKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctagactccctgtcgctcttcactagcctcggcctgagcgagcagaaggcc
cgcgagacgctcaagaactcggctctgagcgcgcagctgcgcgaggccgctactcaggct
cagcagaccctgggttccaccattgacaaagctaccgggatcctgttatatggcttggcc
tcccgactcagggatacccggcgtctctccttccttgtaagctacatagccactgccctt
gagtatgtgcggagtcaccccttggaccccatcgacactgtggacttcgagcgggaatgt
ggcgtgggtgtcattgtgaccccagagcagattgaggaggctgtggaggctgctattaac
aggcaccggccccagctcctggtggaacgttaccatttcaacatggggctgctgatggga
gaggctcgggctgtgctgaagtgggcagatggcaaaatgatcaagaatgaagtggacatg
caggtcctccaccttctgggccccaagttggaggctgatctggagaagaagttcaaggtg
gcaaaagctcggctagaagaaacagaccggaggacggcaaaggatgtggtggagaatggc
gagactgctgaccagaccctgtctctgatggagcagctccggggggaggcccttaagttc
cacaagcctggtgagaactacaagaccccaggctatgtggtcactccacacaccatgaat
ctactaaagcagcacctggagattactggtgggcaggtacgtacccggttcccgccagaa
cccaatggaatcctgcatattggacatgccaaagccatcaatttcaactttggctatgcc
aaggccaacaatggcatctgttttctgcgttttgatgacaccaaccctgagaaggaggaa
gcaaagttcttcacggccatctgtgacatggtagcctggctaggctacacaccttacaaa
gtcacatatgcgtctgactattttgaccagctatatgcgtgggctgtggagctcatccgc
aggggtctggcttatgtgtgccaccagcgaggagaggagctcaaaggccataatactctg
ccttcaccctggagagaccgtcccatggaggagtcactgctgctctttgaggcaatgcgc
aagggcaagttttcagagggcgaggccacactacggatgaagctggtgatggaggatggc
aagatggaccctgtagcctatcgagtcaagtatacaccacaccaccgcacaggggacaaa
tggtgcatctatcccacctacgactacacacactgcctctgtgactccatcgagcacatc
actcactcactctgcaccaaggaattccaggcccgacgctcttcctacttctggctttgc
aatgcactggacgtctattgccctgtgcagtgggagtatggccgcctcaacctgcactat
gctgttgtctctaagaggaagatcctccagcttgtagcaactggtgctgtgcgggactgg
gatgacccacggctctttacactcacggccctgcgacggcggggcttcccacctgaggcc
atcaacaacttctgtgcccgggtgggagtgactgtggcacaaaccacaatggagccacat
cttctagaagcctgtgtgcgtgatgtgctgaatgacacagccccacgagccatggctgtg
ctggagtcactacgggtcatcatcaccaactttcctgctgccaagtccttggacatccag
gtgcccaacttcccagctgatgagaccaaaggcttccatcaggttccctttgcacccatt
gtcttcattgagaggactgacttcaaggaggagccagagccaggatttaagcgcctggct
tggggccagcctgtgggcctgaggcatacaggctacgtcattgagctgcagcatgttgtc
aagggccccagtggttgtgtagagagtctggaggtgacctgcagacgggcagatgctgga
gagaagccaaaggcctttattcactgggtgtcacagcctttgatgtgtgaggttcgcctc
tatgagcgactattccagcacaagaaccctgaagatcctactgaggtgcctggtggattt
ttaagtgacctgaacctggcatcactacacgtggtggatgcagcattagtggactgctct
gtggccctggcaaaacccttcgacaagttccagtttgagcgtcttggatatttctccgtg
gatccagacagccatcagggaaagcttgtctttaaccgaactgtcacactgaaggaagac
ccaggaaaggtgtga

DBGET integrated database retrieval system