KEGG   Homo sapiens (human): 5860Help
Entry
5860              CDS       T01001                                 

Gene name
QDPR, DHPR, PKU2, SDR33C1
Definition
quinoid dihydropteridine reductase (EC:1.5.1.34)
Orthology
K00357  
dihydropteridine reductase [EC:1.5.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Disease
H00167  
Phenylketonuria (PKU)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    5860 (QDPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     5860 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p15.31
AA seq 244 aa AA seqDB search
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSF
TEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSH
LATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAV
LPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELT
PAYF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggctgcaggcgaggcgcgccgggtgctggtgtacggcggcaggggc
gctctgggttctcgatgcgtgcaggcttttcgggcccgcaactggtgggttgccagcgtt
gatgtggtggagaatgaagaggccagcgctagcatcattgttaaaatgacagactcgttc
actgagcaggctgaccaggtgactgctgaggttggaaagctcttgggtgaagagaaggtg
gatgcaattctttgcgttgctggaggatgggccgggggcaatgccaaatccaagtctctc
tttaagaactgtgacctgatgtggaagcagagcatatggacatcgaccatctccagccat
ctggctaccaagcatctcaaggaaggaggcctcctgaccttggctggcgcaaaggctgcc
ctggatgggactcctggtatgatcgggtacggcatggccaagggtgctgttcaccagctc
tgccagagcctggctgggaagaacagcggcatgccgcccggggcagccgccatcgctgtg
ctcccggttaccctggataccccgatgaacaggaaatcaatgcctgaggctgacttcagc
tcctggacacccttagaattcctagttgaaactttccatgactggatcacagggaaaaac
cgaccgagctcaggaagcctaatccaggtggtaaccacagaaggaaggacggaactcacc
ccagcatatttttag

DBGET integrated database retrieval system