KEGG   Homo sapiens (human): 5864Help
Entry
5864              CDS       T01001                                 

Gene name
RAB3A
Definition
RAB3A, member RAS oncogene family
Orthology
K07882  
Ras-related protein Rab-3A
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    5864 (RAB3A)
  Nervous system
   04721 Synaptic vesicle cycle
    5864 (RAB3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   5864 (RAB3A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5864 (RAB3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 220 aa AA seqDB search
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV
DVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgccacagactcgcgctatgggcagaaggagtcctcggatcagaacttcgac
tacatgttcaagattctcatcatcggcaacagcagcgtgggcaagacgtccttcctcttc
cgctatgctgacgactcgttcacgcctgccttcgtcagcaccgtgggcatcgacttcaag
gtcaagaccatctatcgcaacgacaagaggatcaagctgcagatctgggacacagcaggg
caagagcggtaccggaccatcaccaccgcatactaccggggcgctatgggcttcatcctc
atgtatgacatcaccaacgaggaatccttcaatgcagtgcaggactggtccacccagatc
aagacctactcatgggacaatgcccaggtgctgctggtaggaaacaagtgtgacatggag
gatgagcgggtggtgtcatcagaacgtggccggcagctagctgaccaccttgggttcgag
ttctttgaggcaagcgccaaggacaacattaacgtcaagcagacctttgagcgcctggtg
gatgtcatctgcgagaagatgtccgagtcgttggacacggcggaccctgcggtcacaggc
gccaagcagggcccacagctcagtgaccagcaggtgccaccgcaccaggactgcgcctgc
tga

DBGET integrated database retrieval system